KEGG   Paenibacillus durus: PDUR_06960Help
Entry
PDUR_06960        CDS       T03297                                 

Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
pdu  Paenibacillus durus
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pdu00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    PDUR_06960
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    PDUR_06960
Enzymes [BR:pdu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     PDUR_06960
Peptidoglycan biosynthesis and degradation proteins [BR:pdu01011]
 Precursor biosynthesis
  Racemase
   PDUR_06960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1480032..1481234
Genome map
AA seq 400 aa AA seqDB search
MQESYRPTVAEIDLDALRANYESFRRHLPAGVKFMVCVKGNAYGHGAVEVTRELERLGAD
YVSVAFLDEAIELRQAGIVLPILVLGYTPPEAIAAAWENDVTVTLFTPEVLEAASKLPFN
DSRKLKVHIKIDSGMGRLGLLPDDAPLFIDKAQRVRQIELEGMFTHFAKADEADKSYTLE
QYRRFMGVTEALRERQIHIPIIHTGNSATAIDTPHLSPNMVRVGVSIYGFYPSTEVNRQQ
VELHPVMTLKTKAVYVKSLPESWGVSYGTRYRAVSGEYIATLPIGYADGYSRMLSGKAEV
LIRGRRVPVVGTICMDQCMVSLKSFANEAEQIKAGEEVVLIGRQAGVSITADELALLLGT
IHYEVTCMLAHRVPRVYIREGSAPRLVNALIQTPSPNPVS
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
gtgcaagaaagttatcgaccgactgtggccgagattgatttggatgccttgcgtgccaat
tacgaaagctttcggcggcatttgccggcgggagtgaagtttatggtatgcgtcaaaggc
aatgcatacggccacggggccgtggaagtgacgcgtgaactggaacgactgggtgcggac
tatgtaagcgtggcttttctggatgaggcgatcgagctgcgccaggcgggaattgtcctg
ccgattctagtgcttggctatacgccgccggaagctattgccgccgcctgggagaacgat
gtgaccgtgacgctttttaccccggaagtgctggaagcggcatctaaacttcctttcaat
gacagccggaagttgaaggtgcatatcaagattgacagcggcatgggccggctcgggctt
cttccggatgatgctccgctgttcatcgacaaggcgcagcgtgtccggcagatcgaattg
gaggggatgttcacacattttgccaaagcggatgaagcagacaaaagctatacactggag
cagtaccgacgattcatgggcgtgacggaagcgcttcgggaaagacagattcatatcccg
atcatacatacgggcaacagcgctacggccattgacacccctcatttatctccgaacatg
gtgcgtgtgggcgtcagcatatacggattctacccgtcaactgaggtgaacagacagcag
gtcgagctgcacccggtcatgacgctgaagacgaaagccgtctatgtaaaaagcctgccg
gagagctggggcgtcagctacggaacccgctaccgcgcagtcagcggcgaatatatcgcc
acgctacccatcgggtacgcggacggatattcccgcatgctgagcggtaaggcagaggtg
ctaatacgcggccgccgcgttcctgtcgtcggaaccatctgcatggaccagtgtatggta
tcgctcaaatctttcgccaatgaggcggaacaaatcaaagccggcgaagaggttgtactc
atcggccgccaggctggcgtctccattacggcagacgagctggcactccttcttggaacg
attcactacgaggtgacctgcatgctggcccatcgggtgccgcgcgtttatattcgcgaa
ggctcggctccccgtctggtaaatgccttaattcaaaccccaagccccaatcctgtaagc
taa

DBGET integrated database retrieval system