KEGG   Planococcus faecalis: AJGP001_13980Help
Entry
AJGP001_13980     CDS       T04955                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
pfae  Planococcus faecalis
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfae00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    AJGP001_13980
Enzymes [BR:pfae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     AJGP001_13980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(2805264..2805854)
Genome map
AA seq 196 aa AA seqDB search
MYVMKQTGWVELICGSMFSGKSEELIRRVRRSQFAKQKIAVFKPKIDDRYSKEEVVSHNG
STVIALPISCSSEMWEYITDEFDVIAIDEAQFFDEDIIGNVQKLANHGFRVIVAGLDQDF
RGRPFGPMPALLAIAEQVTKLQAVCTVCGSPASRTQRLIDGKPAGSDDPTILVGASEAYE
PRCRHHHEVPTGVTVK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgtatgttatgaagcaaacaggctgggtcgaattgatctgcgggagcatgttttccggg
aaatcggaagaattgattcgccgtgtccgtcgttcccaatttgctaaacaaaaaattgct
gtatttaaaccgaaaatcgacgatcgttatagtaaagaagaggtcgtttctcataatggt
tcaactgtaattgccttgcccatttcttgctcatctgaaatgtgggaatacattacggat
gaatttgatgtaattgctatagatgaagctcagttttttgacgaagatattattggcaat
gttcagaaactcgccaatcacggattccgtgtaattgttgcgggactcgaccaagacttt
agaggccgtccgttcggaccaatgccagcactactcgcaattgctgagcaagtaacaaaa
cttcaagcagtttgcacagtttgtggttcaccggcaagtcgcacgcaacgtttaatcgac
ggaaaaccggcaggctcggacgatccaaccattttggtcggcgcatcagaagcctacgaa
cctcgctgccgccatcaccatgaagtgccgactggcgttactgttaagtga

DBGET integrated database retrieval system