KEGG   Planococcus faecalis: AJGP001_15070Help
Entry
AJGP001_15070     CDS       T04955                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
pfae  Planococcus faecalis
Brite
Enzymes [BR:pfae01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AJGP001_15070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
3032712..3033347
Genome map
AA seq 211 aa AA seqDB search
MKRWLLFGLIVSFLVLLAACGNDTTEDPPTESDGATEETNDDSNSSEDSTEGAATNNDGE
ILMVTVELMNSDGDAIGTAELTEEDSGVAVALQAENLEQGMHGIHFHQEGMCEVPDFKSA
GDHFNPESTMHGMDNADGPHAGDLPNLEVGEDGSVSQEFVAENVTLEIGEEDSLLKEGGT
ALVIHAGEDDQKTDPSGDSGDRIACGVIAAE
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgttggttgttgttcggtttaatcgtaagctttttagtccttttagcagcttgt
ggcaatgacacgacagaagatccgcctacggaatctgatggcgcaacagaagaaacgaac
gatgacagcaacagcagtgaagattcaactgaaggagcagctactaataacgatggcgaa
atcctgatggtaaccgtcgaattaatgaacagtgacggtgatgcaataggcactgctgaa
ttgactgaagaagacagcggtgtcgcggtcgcacttcaagcagaaaatttagaacaaggc
atgcatggtattcacttccaccaagaaggtatgtgtgaagttcctgacttcaaatcagct
ggtgatcactttaatccagaaagtacgatgcatggtatggacaacgctgacggtccgcat
gccggtgacttgccgaaccttgaagtaggcgaagacggcagcgtctcacaagaatttgtt
gccgaaaatgtgacgcttgaaattggcgaagaggattcactactcaaagaaggcggaact
gcgcttgttattcacgcaggagaagatgatcaaaaaaccgatccttctggtgactctgga
gaccgcattgcctgtggcgtcattgccgcagaataa

DBGET integrated database retrieval system