KEGG   Pseudomonas synxantha LBUM223: VO64_4398Help
Entry
VO64_4398         CDS       T03769                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pfb  Pseudomonas synxantha LBUM223
Pathway
pfb00620  Pyruvate metabolism
pfb00680  Methane metabolism
pfb01100  Metabolic pathways
pfb01120  Microbial metabolism in diverse environments
pfb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pfb00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VO64_4398
  Energy metabolism
   00680 Methane metabolism
    VO64_4398
Enzymes [BR:pfb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     VO64_4398
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AKA84944
UniProt: A0A0E3MP59
LinkDB All DBs
Position
4925511..4928138
Genome map
AA seq 875 aa AA seqDB search
MSDIDARLREDVHLLGELLGNTIREQYGDDFLDKIEQIRKGAKADRRGAGDELSTRLNQL
QEDELLPVARAFNQFLNLANIAEQYQLIHRRDESQPAPFESRVLQELLARLQGEGHSNES
LARQLARLEIELVLTAHPTEVARRTLIQKYDAIAAQLALQDHRDLTSAEREQIRTRLQRL
IAEAWHTEEIRRVRPTPVDEAKWGFAVIEHSLWHAIPNYLRKADQALFAATGLRLPLEAA
PIRFASWMGGDRDGNPNVTAPVTREVLLLARWMAADLYLRDIDHLASELSMQQASPALQA
KVGDSVEPYRALLKQLRERLRATRQWAHTSLTATTAAPAEVLQDNRDLLDPLELCYQSLH
ECGMGVIADGPLLDCLRRAVTFGLFLVRLDVRQDSSRHCAAMTEITDYLGLGRYEDWEED
ARISFLTQELANRRPLLPGYFKPSADTAEVLNTCKEIAAAPAASLGSYVISMAGAASDVL
AVQLLLKESGVQRPMRVVPLFETLADLDNAGPVMERLLQLPGYRARLQGPQEVMIGYSDS
AKDAGTTAAAWAQYRAQERLVDICREQQVELLLFHGRGGTVGRGGGPAHAAILSQPPGSV
AGRFRTTEQGEMIRFKFGLPDIAEQNLNLYLAAVLEATLLPPPPPEPAWRHLMDELAADG
VSAYRAVVRENPQFVEYFRQSTPEQELGRLPLGSRPAKRRAGGIESLRAIPWIFGWTQTR
LMLPAWLGWEAALSKALERGEGPLLGQMREQWPFFRTRIDMLEMVLAKADADIARLYDER
LVQADLLPLGAHLRDLLSQACGVVLGLTGQSQLLAHSPDTLEFIRLRNTYLDPLHLLQAE
LLARSRQQEAAQDSPLEQALLVSVAGIAAGLRNTG
NT seq 2628 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatatcgatgcacgcttgcgtgaggatgttcacctgctgggtgagctgttgggc
aacaccattcgagagcagtacggcgatgatttcctcgataagatcgagcagatccgcaaa
ggcgccaaggccgaccgtcgcggcgccggcgatgaactgagcacccgtctgaaccagttg
caggaagacgaattgctgcccgtggcccgggccttcaaccagttcctcaacctggccaac
attgccgagcaatatcagttgattcatcggcgcgatgagtcgcaacccgcgccgttcgaa
tcccgagtcttgcaggagttgctggcccgtctgcaaggcgaggggcacagcaatgaatcc
ctggcccgccagttggcacggttggagattgagctggtgctcaccgcccaccccactgaa
gtggctcgccgcaccctgatccagaaatacgatgcaatcgccgcgcaactggccttgcag
gatcaccgcgacctcaccagtgccgagcgggagcagatccgcacacgcctgcaacgactg
atcgccgaagcctggcataccgaggaaatccgccgcgtccggcccaccccggttgacgaa
gccaaatggggcttcgcggtcatcgagcattcgctgtggcacgccatccccaattacctg
cgcaaggctgaccaggccctgtttgccgctaccgggctgcgcctgcccctggaggcagcg
ccgattcgctttgcatcgtggatgggcggcgaccgtgacggcaacccgaatgtaaccgcg
ccggtcacccgcgaagtgctgttgttggcacgctggatggcggctgacttgtatttgcgc
gacatcgaccacctggcctccgagttgtcgatgcaacaagccagcccggcgttgcaggcc
aaggttggcgacagcgtcgagccctatcgagccttgcttaagcaactgcgtgagcgcctg
cgtgcgacgcgccagtgggcccacacgtcgttgaccgccaccacagcggcgcctgccgag
gtgttgcaggacaaccgcgacctactggacccgctggagttgtgctaccagtcgctgcat
gaatgcggcatgggcgtgattgccgatggcccgctgctcgactgcctgcgacgcgccgtg
accttcggcctgttcctggtgcgcctggatgtgcgccaggattccagccgccattgcgcg
gccatgaccgaaatcaccgactacctgggcctgggccgttatgaggactgggaagaagac
gcgcgcatcagcttcctcacccaggagctggccaatcgtcggcctctgctgccgggctat
ttcaagccgtcggcggacaccgccgaagtgttgaatacctgcaaggaaatcgccgccgca
ccggcggcatcattgggttcgtacgttatctccatggcgggcgccgcgtcggatgtgctg
gcggtgcagttgctgctcaaagagtcgggcgtacaacggccgatgcgcgtggtgccgctg
ttcgagaccctggccgacctggataacgccgggccggtgatggagcggctattgcaactg
ccgggctatcgcgcacggttgcagggcccgcaggaagtaatgatcggctactcggactcg
gccaaggacgccggtaccaccgctgcggcctgggcgcagtaccgggcgcaggagcggttg
gtggatatttgccgcgagcagcaggtggagctgctgctgttccacggtcgcggcggcacg
gtcggccgtggcggcggcccggctcacgcggcgatcttgtcgcagccaccgggctcggtg
gcggggcggttccgtacgactgaacaaggcgagatgattcgcttcaaattcggcctgccg
gatattgccgagcaaaacctcaacctctacctggctgccgtgctggaagcgacattgttg
ccaccgccgccaccggaaccagcctggcgtcatctgatggatgagttagcggccgatggt
gtcagcgcttaccgtgccgtcgtacgggaaaacccgcaattcgtcgaatactttcgccag
tccaccccggagcaggaactgggccggttgcccctgggcagtcgtccggccaagcgccgg
gccggcggtattgaaagcctgcgtgccattccgtggattttcggctggacccagacgcgc
cttatgctgcccgcctggctcggttgggaagcggcattgagcaaggcgctggagcgcggt
gaaggcccgttgctggggcagatgcgtgaacagtggccgttcttccgcacgcgcatcgac
atgctggaaatggtgttggccaaggcggatgccgatatcgcccgtctttatgatgagcgc
ctggtgcaggcggacctgctgccattgggcgcgcatttacgcgacctattgtcgcaggcg
tgtggcgtggtgcttggcctgaccgggcagtctcagctgctggcccatagccccgacact
ctggagttcatccgccttcgcaacacctacctcgaccctttgcacttgttgcaggccgag
ttgctggcacgttcgcgtcaacaggaggcggcgcaagacagccctctggaacaggcgctg
ctggtgtccgtcgccggtattgccgccggtttgcgcaacaccggttga

DBGET integrated database retrieval system