KEGG   Pseudomonas fluorescens A506: PflA506_4617Help
Entry
PflA506_4617      CDS       T02114                                 

Gene name
aepX
Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
pfc  Pseudomonas fluorescens A506
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pfc00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    PflA506_4617 (aepX)
Enzymes [BR:pfc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     PflA506_4617 (aepX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(5093413..5094303)
Genome map
AA seq 296 aa AA seqDB search
MMDTEARRRPLSALLASNRCLRVLEAHSPISALLAQRARLEISPGHTVGYDAIWSSSLTD
STQRGLPDIEILSPSNRLPGIREIFDVCSLPLIFDADTGGKAEHFAIHIKMLERAGVSAV
VIEDKCGLKKNSLLGIEVEQAQESIEAFCAKLQAGCTSRTGSGLMMIARCESLILDRGME
EAMARCLAYVEAGADGIMIHSRKQDGLEILEFARQFRLQRPRVPLICVPTSYVHLKFEVL
ERAGFNAVIYANHMLRSAYLAMRDTAVGILANGRTLELEPRCLGIDEILDLVPGTR
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgatggataccgaagcgcgccgacgccctctgtcggcgctattggctagcaaccgttgc
ctgcgtgtactcgaagcccatagcccgatatcggcgttgctcgcgcagcgcgccaggctg
gaaatcagcccagggcatacggtggggtacgacgccatctggtcgagttcgctgaccgac
tcgacccagcgcgggttacccgacatcgaaattctttcgcccagtaaccgattgccgggg
attcgcgaaatcttcgatgtgtgctcgctgccgctgatattcgatgccgataccggcggt
aaggccgaacatttcgcgattcatatcaagatgctggagcgcgcaggcgtctcggcggtg
gtgatcgaagacaaatgcggcctgaagaagaattcactcttgggcatcgaggtcgagcag
gcgcaggagtccatcgaggccttttgcgccaagctccaggccgggtgcacgagtcgcacc
ggctcagggctgatgatgattgcccggtgtgaaagcttgattctggatcgcggcatggaa
gaggcgatggcgcggtgcctggcgtatgtggaggcgggggcggatggcatcatgatccac
agccgcaagcaggatggcctggaaattctggaattcgcccggcagtttcgcctgcagcgg
cccagggtaccgctgatttgtgtgccgaccagctatgttcacctgaagttcgaggtgctg
gagcgagcaggtttcaacgcggtgatttatgccaatcacatgttgcgcagtgcctacctg
gccatgcgcgatactgccgtcggcatactcgccaatggcaggacgctggaactggagcca
cgttgcctgggcatcgacgagatactcgacctggtgcccggtacgcgctag

DBGET integrated database retrieval system