KEGG   Pyrococcus furiosus COM1: PFC_10430Help
Entry
PFC_10430         CDS       T02183                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
pfi  Pyrococcus furiosus COM1
Pathway
pfi03030  DNA replication
pfi03410  Base excision repair
pfi03420  Nucleotide excision repair
pfi03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pfi00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    PFC_10430
   03410 Base excision repair
    PFC_10430
   03420 Nucleotide excision repair
    PFC_10430
   03430 Mismatch repair
    PFC_10430
Enzymes [BR:pfi01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     PFC_10430
    6.5.1.6  DNA ligase (ATP or NAD+)
     PFC_10430
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     PFC_10430
DNA replication proteins [BR:pfi03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    PFC_10430
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     PFC_10430
DNA repair and recombination proteins [BR:pfi03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     PFC_10430
   NER (nucleotide excision repair)
    Other NER factors
     PFC_10430
   MMR (mismatch exicision repair)
    Other MMR factors
     PFC_10430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: AFN05005
UniProt: I6V1U3
LinkDB All DBs
Structure
PDB: 

Jmol
Position
complement(1877584..1879269)
Genome map
AA seq 561 aa AA seqDB search
MRYLELAQLYQKLEKTTMKLIKTRLVADFLKKVPDDHLEFIPYLILGEVFPEWDERELGV
GEKLLIKAVAMATGIDAKEIEESVKDTGDLGESIALAVKKKKQKSFFSQPLTIKRVYQTL
VKVAETTGEGSQDKKVKYLADLFMDAEPLEAKYLARTILGTMRTGVAEGLLRDAIAMAFH
VKVELVERAYMLTSDFGYVAKIAKLEGNEGLAKVQVQLGKPIKPMLAQQAASIRDALLEM
GGEAEFEIKYDGARVQVHKDGSKIIVYSRRLENVTRAIPEIVEALKEAIIPEKAIVEGEL
VAIGENGRPLPFQYVLRRFRRKHNIEEMMEKIPLELNLFDVLYVDGQSLIDTKFIDRRRT
LEEIIKQNEKIKVAENLITKKVEEAEAFYKRALEMGHEGLMAKRLDAVYEPGNRGKKWLK
IKPTMENLDLVIIGAEWGEGRRAHLFGSFILGAYDPETGEFLEVGKVGSGFTDDDLVEFT
KMLKPLIIKEEGKRVWLQPKVVIEVTYQEIQKSPKYRSGFALRFPRFVALRDDKGPEDAD
TIERIAQLYELQEKMKGKVES
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgaggtatctagagcttgctcaactttatcaaaagttagaaaagacaactatgaaactt
ataaagactagacttgtcgccgacttcctgaaaaaagtaccagatgatcatctggagttc
attccctatctaattcttggagaagtttttccagagtgggatgaaagggagctgggtgtg
ggagaaaagctgttaattaaagctgtagcaatggccactggaattgacgcaaaagaaatc
gaagagtctgtaaaagatactggagaccttggagagagcatagccttagctgtaaagaaa
aagaagcagaagagcttcttctctcagcccctcacaataaagagggtatatcaaaccctt
gtaaaggttgcagaaacaacgggggagggaagccaagataaaaaagtaaagtatctagct
gatttgttcatggacgcagaacctttagaagctaagtatcttgctcgtacaatcttagga
acaatgagaacaggagttgcagaaggattgcttagagatgcaatagcaatggcattccac
gtaaaggtagagcttgttgagagagcttacatgctaacgagtgatttcggatatgtagct
aaaatagcaaagcttgaaggaaatgaagggctagcaaaagttcaagttcaactcggaaag
ccaataaagccaatgcttgcccagcaagctgctagcataagagatgcacttctcgagatg
ggtggagaggcagagttcgagattaaatacgatggagcaagggtgcaggtgcacaaggat
ggctcaaaaattatagtctattctagaagactggagaacgtcaccagagcgattccagaa
attgttgaggctctaaaagaggcaataatacctgaaaaggcaatagtggaaggagaactt
gtggcaattggagaaaacggaagaccattgcccttccaatatgtgcttagaaggtttagg
agaaagcataacatagaagaaatgatggaaaagatacctctcgagctcaacttattcgac
gttctctacgtagatggacaaagcttgattgacactaagttcattgatagaagaagaaca
cttgaagaaataataaagcagaatgaaaagataaaggtagcagaaaacctaataacaaag
aaagtcgaggaagcagaggcattttacaagagagcactcgaaatggggcacgagggattg
atggccaagaggttagatgcagtctacgaaccaggtaacagaggaaagaagtggttgaag
ataaagcccacaatggagaacttagatttagtaatcataggagcagaatggggagaggga
agaagagcccatctctttggttcattcatcctgggagcatatgatccagaaacaggagaa
ttcctagaggtaggaaaagtgggaagtggattcacagatgatgacttagttgagtttacg
aagatgctaaagccccttattataaaagaggaaggaaagagagtctggctccagcccaaa
gttgttattgaagtgacatatcaagaaattcagaagagtccaaaatacagaagtggattt
gcattaaggttcccaaggttcgttgcacttagagatgataaaggaccagaagatgcagat
acaatagagagaatcgcacaactttacgagttgcaagaaaagatgaaaggaaaagtggaa
agctaa

DBGET integrated database retrieval system