KEGG   Pseudocercospora fijiensis: MYCFIDRAFT_132548Help
Entry
MYCFIDRAFT_132548 CDS       T03109                                 

Definition
(RefSeq) hypothetical protein
  KO
K10777  
DNA ligase 4 [EC:6.5.1.1]
Organism
pfj  Pseudocercospora fijiensis
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:pfj00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    MYCFIDRAFT_132548
Enzymes [BR:pfj01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     MYCFIDRAFT_132548
DNA repair and recombination proteins [BR:pfj03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     MYCFIDRAFT_132548
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 967 aa AA seqDB search
MYGRGTMTEQELDEKYPNRPHNHSRTLPFRDLFFTLFNPLNDNRKKPSGPAIARKKLGSY
GGPSQAPNEVRRQIIDRFISRWRKEVGDDIYPAMRLIVPEKDRDRGMYGLKEMTIAKLLV
KILKIDKNSDDGRNLTHWKQPGLNSTSAMAGDFAGRCFEVISKRPMRTTPGDMTIAEVNE
RLDRLAVAQKEENQLPILEQFYSRMNAEEMMWLVRMILRQMKVGATEKTFFEIWHPDAET
LFNISSSLRRVCWELYDPAVRLEGESRGICLMQCFQPQLAAFQMRSTEHMVAKMGTTDED
PVFWIEEKLDGERMQMHVMEDDDHPGGVRFGFWSRKAKDYTYLYGSGFEDDHSALTRHIK
DAFASGVRNIILDGEMITWDIQLDAIVTFGTLKTAAIEQQQNPFADGNRPLYRVFDCLYL
NDKDLTRYTLRDRRNALQCSIKNVRRRIEIHEYQEEKTASKVDETLRRVVAEASEGLVLK
NPRSLYHLNARNDDWIKVKPEYMTEFGESLDCIVVGGYYGSGKRGGGLSSFLCGLYVPSQ
KKEIQPDINPQKTLSFFKVGGGFSASDYAQIKHMTEGKWNDWDRKKPPFDWVELGGGMVK
QYERPDVWIKPEDSFVVSVKAASVGASDQFACGFTLRFPRFKKLRTDKSWQQALSHDDFI
ELKTKAQNEKEEKKMKMDESRRGRKTKKRKKEIVIQGQEEGDLKTPYAGPVTKVFEGLSF
FIMTEAPKPIKKSKAELEQLVKANGGQIVASHKDPKTILVADRNVVKVASVKKSDNRNIV
KPSWLLDCIKQSELDVGRPTLLLPLEPHHLEYTQSADQGKFDDNVDEYGDSYARDVTPSS
LLALCNKMPAKVEDGYEPLEILEQLNEQNNELDALAGFMFRGTKAYIEPSIPRESIRLYE
FAGGDLAKTLKDEDITQVVVQQGSQSLADIRKAVSSRSKLPRIVTEDWVKESWIEETRLD
EERFAPV
NT seq 2904 nt NT seq  +upstreamnt  +downstreamnt
atgtatgggcgtggcacgatgacagaacaagaactcgacgagaagtatccaaatcgccct
cacaatcactcccgaactctgccatttcgcgatctcttcttcaccctgttcaaccctctc
aacgacaacagaaagaagccatccgggccagcaattgcccgtaagaagctgggctcttat
ggcggaccgagtcaagctccaaatgaagtgcgacgccagatcatcgacaggttcatcagt
cggtggcggaaggaagtcggcgacgacatctatcccgccatgcgtctcatcgttcccgaa
aaggaccgtgatcgaggcatgtatggactcaaagagatgaccatcgctaaacttctcgtc
aaaattctcaaaattgacaagaacagcgatgatggtcggaatctcacgcactggaaacag
ccgggcctgaattcgacgagtgccatggccggagactttgcaggccgctgttttgaggtc
atcagcaagcgacctatgcgcacaacacctggcgacatgaccattgctgaagtcaacgag
cgtcttgatcgtctggcggttgcacaaaaggaagaaaatcagctgccaattctcgagcag
ttttacagtcgcatgaacgccgaagaaatgatgtggctcgttcgcatgattcttcgtcag
atgaaggtcggtgcgacggaaaagaccttcttcgaaatctggcacccggatgcagagact
ctcttcaatatctcaagtagtctgagacgcgtctgctgggagctttatgatcctgcagtg
cgcttggagggcgagagtcgcgggatttgcttgatgcaatgcttccagccacagctcgct
gccttccagatgcgctcgaccgagcacatggtcgcgaaaatgggcacgacggacgaagat
cctgtgttctggattgaagaaaagcttgacggagaacgcatgcagatgcacgtgatggag
gacgatgaccacccgggcggtgtgcgcttcggcttctggtcgcgaaaggcgaaagattac
acttatctgtacggcagcggctttgaggacgaccactccgctttgacgcgacatatcaag
gacgcgttcgcgtcaggcgttcgtaacatcattcttgatggcgagatgatcacgtgggac
attcagctggatgctatagtcaccttcggcacgctgaaaacagccgccatcgagcagcag
cagaatcctttcgcagatggtaatcggcctctatacagagtattcgactgcctatatctc
aatgacaaagacctgacacgctacacccttcgcgatcgccgaaatgcgttgcaatgcagt
atcaagaatgtccgtcgtcggattgaaatccatgaatatcaagaagaaaagactgcatca
aaagtggacgaaactctacggcgagtcgtggcagaggcgagcgagggccttgtgctcaag
aatcctcgatcactgtatcatctgaatgcacgtaatgacgattggatcaaagtcaagcca
gagtacatgaccgagttcggcgaatcactcgattgcatcgtcgtgggaggctactatggc
tctggcaagcgcggtgggggtctgagcagctttttgtgcggactctatgtgcccagccaa
aagaaagagatccagccagatatcaaccctcaaaagacgctgtcattcttcaaagtcgga
ggaggcttcagcgccagcgattacgcgcagatcaaacacatgaccgaaggcaagtggaac
gactgggatcggaagaaacctccatttgactgggtcgaacttggcggaggcatggtcaag
cagtatgagagaccggatgtctggatcaagcccgaagactccttcgtcgtgagcgtgaaa
gccgcatcggttggggcctctgaccaattcgcttgcggcttcaccttacgctttccaagg
ttcaagaaattgcggactgacaagtcctggcagcaggcactgtcacacgacgacttcatt
gagctcaagaccaaagcacagaatgagaaggaggagaaaaagatgaagatggacgagtcg
cggagaggacgcaagacaaagaagcggaagaaggagatcgtgattcagggccaagaagaa
ggcgacctcaagacaccttacgccggtcctgtgacaaaagtcttcgaaggtctgagcttc
ttcatcatgactgaagccccgaagccgatcaagaagagcaaagccgagctcgaacaactt
gtcaaagcgaacggtggccagattgtggcatcacacaaggatcctaaaaccattcttgtt
gctgatcggaatgtagtcaaggtcgcctcggtgaaaaagagcgacaaccgaaacatcgtt
aagccaagctggctactcgattgcatcaagcagagcgaactagacgttggaagaccgact
ttgctcctccctctcgagccgcaccaccttgaatatacgcagtctgctgaccaaggcaag
ttcgatgacaacgttgacgagtatggtgacagctatgctcgcgatgtcacgccttccagc
ctcctcgctttgtgcaataaaatgccagccaaggttgaagacggatatgagcctctcgaa
atcctggaacaactcaatgagcagaacaacgagctcgatgccctcgctggattcatgttc
cgcggcacgaaagcatacatcgaaccaagtatacctcgagagagcataaggctgtatgag
ttcgctggtggtgacctcgccaagacattgaaagatgaggatatcacacaagttgtcgtt
cagcagggcagccagagccttgcggatattcgcaaagcagtctcttctagaagtaagcta
cctagaattgtgactgaggactgggtcaaagagagctggatcgaggagacgagactagac
gaggagcgttttgcacctgtctag

DBGET integrated database retrieval system