KEGG   Pseudomonas fluorescens Pf0-1: Pfl01_3983Help
Entry
Pfl01_3983        CDS       T00283                                 

Definition
(GenBank) putative aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
pfo  Pseudomonas fluorescens Pf0-1
Pathway
pfo00220  Arginine biosynthesis
pfo00250  Alanine, aspartate and glutamate metabolism
pfo00290  Valine, leucine and isoleucine biosynthesis
pfo01100  Metabolic pathways
pfo01110  Biosynthesis of secondary metabolites
pfo01130  Biosynthesis of antibiotics
pfo01210  2-Oxocarboxylic acid metabolism
pfo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pfo00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Pfl01_3983
   00290 Valine, leucine and isoleucine biosynthesis
    Pfl01_3983
   00220 Arginine biosynthesis
    Pfl01_3983
Enzymes [BR:pfo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     Pfl01_3983
    2.6.1.66  valine---pyruvate transaminase
     Pfl01_3983
Amino acid related enzymes [BR:pfo01007]
 Aminotransferase (transaminase)
  Class I
   Pfl01_3983
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Costars
Motif
Other DBs
NCBI-ProteinID: ABA75720
UniProt: Q3K934
LinkDB All DBs
Position
4511731..4512942
Genome map
AA seq 403 aa AA seqDB search
MQFSKSNKLANVCYDIRGPVLKHAKRLEEEGHRILKLNIGNPAPFGFEAPDEILQDVIRN
LPTAQGYSDSKGLFSARKAVMQYYQQKQVEGVGIEDIYLGNGVSELIVMSLQALLNNGDE
VLVPAPDYPLWTAAVSLAGGNAVHYLCDEGADWFPDLADIKAKITPNTKAMVIINPNNPT
GAVYSKEVLLGMLELARQHNLVVFSDEIYDKILYDDAVHICTASLAPDLLCLTFNGLSKS
YRVAGFRSGWIAISGPKHNAHSYIEGIDMLANMRLCANVPSQHAIQTALGGYQSINDLVL
PQGRLLEQRNRTWELLNDIPGVSCVKPMGALYAFPKIDPKVCPIHNDEKFVLDLLLSEKL
LVVQGTAFNWPWPDHFRVVTLPRVDDLDMAIGRIGNFLKSYRQ
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcagttcagcaaatcgaacaagctcgccaacgtctgctacgacattcgcggcccggtg
ctcaagcacgccaaacgcctggaagaggaaggccatcgcatcctcaagctgaacatcggc
aacccggcaccctttggtttcgaagcgccagacgaaattctccaggatgtgatccgcaac
ctgccgaccgcccagggctacagcgattccaaaggcctgttcagcgcgcgcaaggcggtg
atgcagtactaccagcagaagcaggtcgaaggtgtcggcatcgaagacatctatctgggc
aacggcgtgtccgagctgatcgtgatgtcgctgcaggcactgctcaacaacggtgacgaa
gtgctggtgccggcgccagactacccgctgtggaccgcagccgtgagcctggccggcggt
aacgctgtgcattacctgtgcgacgagggcgccgactggttcccggacctggccgacatc
aaggccaagatcaccccgaacaccaaggcgatggtgatcatcaacccgaacaacccgacc
ggcgcggtgtattcgaaggaagtgctgttgggcatgctcgaactggctcgccagcacaat
ctggtggtgttctccgacgaaatctacgacaagattctttacgacgacgccgtgcacatc
tgcaccgcttcgctggccccggacctgctgtgcctgaccttcaacggcctgtccaagtcg
tatcgcgtggcgggtttccgttccggctggatcgccatttccgggccgaaacacaacgct
cacagctacatcgaaggcatcgacatgctggccaacatgcgcctgtgcgccaacgtgccg
agtcagcatgcgatccagaccgccctgggtggctatcagagcatcaacgatctggtactg
ccgcaaggtcgcctgctggaacagcgcaaccgcacctgggagctgctcaacgacattccc
ggcgttagctgcgtgaagccgatgggcgcactgtacgcgttcccgaagatcgacccgaaa
gtctgcccgatccacaacgacgagaaattcgtgctcgacctgctgctctccgagaagctg
ctggtggtgcagggcacggcgttcaactggccgtggcctgaccacttccgcgtggtcacc
ctgccgcgggtcgatgacctggacatggccatcggtcgcatcggcaacttcctcaagtcc
taccgccagtaa

DBGET integrated database retrieval system