KEGG   Propionibacterium freudenreichii subsp. freudenreichii DSM 20271: RM25_2222Help
Entry
RM25_2222         CDS       T03860                                 

Definition
(GenBank) Glutamate decarboxylase
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
pfre  Propionibacterium freudenreichii subsp. freudenreichii DSM 20271
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Quorum sensing
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:pfre00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    RM25_2222
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RM25_2222
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RM25_2222
   00430 Taurine and hypotaurine metabolism
    RM25_2222
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    RM25_2222
Enzymes [BR:pfre01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     RM25_2222
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2494220..2495632
Genome map
AA seq 470 aa AA seqDB search
MNDPTRHPTYSIDRSQLGAVEINPVFARPAEATEFSKFRLPASESLPETAYQVVHDEAML
DGNARLNLATFVGTWMDGYANRLYAESADKNMIDKDEYPKTAEIETRCWTMLADLWHAPD
PDNTIGTSTIGSSEACMLGGLALKRRWQHARKAAGKPTDHPNMVMSSAVQVCWEKFCNYW
DIEPRYVPISEDHKVLDGTNLADYVDENTIGVVAIMGVTYTGMYEPVKQIAAALDEIQER
TGLDVKIHVDAASGGMIAPFIQPDLEWDFRVERVASINTSGHKYGLVYPGLGWVVWRSVD
DLPEDLIFKVSYLGGDMPTFALNFSRPGAQVLLQYYMFLRLGMDGFRRVQTNSHDVAKFL
SSQIGAMDDFELWNDGSDIPVFAWRLKDRPNRKWDLYDLSERLRTRGWLVPAYPMPADLT
DVTVQRIVVRNGLSHDLADAFLESMRAEVAYLDALPAPMPSQHKQSGFHH
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
ttgaacgatccgacccgtcatcccacatactcaatcgatcgctcgcagctcggcgctgtg
gagatcaacccggtgttcgcccgccccgcggaggccaccgaattctcgaagttccgcctg
ccggcgtccgagagcctgcccgagaccgcctaccaggtggtgcacgacgaggccatgctc
gacggcaacgcccgcctcaacctggccaccttcgtgggcacctggatggacggctacgcc
aaccgcctctatgccgagtcggctgacaagaacatgatcgacaaggacgaataccccaag
accgccgagatcgagacccgttgctggacgatgctcgccgacctgtggcacgcgcccgac
cccgacaacaccatcggcacgtcgaccatcggctcgtccgaggcctgcatgctgggtggc
ctggcgctgaagcgccgctggcagcacgcccgcaaggccgccggcaagcccaccgaccac
ccgaacatggtgatgtcgtcggccgtgcaggtgtgctgggagaagttctgcaactactgg
gacatcgagccccgctatgtgccgatctcggaggaccacaaggtgctcgacggcaccaac
ctggccgattacgtcgacgagaacaccatcggcgtggtggccatcatgggcgtgacctac
accggcatgtatgagccggtgaagcagatcgccgcggcgctcgacgagatccaggaacgc
accggccttgacgtgaagatccacgtggacgcggcctcgggcggcatgatcgccccgttc
atccagcccgacctggaatgggacttccgcgtcgagcgcgtggcatcgatcaacacctcg
ggccacaagtacgggctggtctaccccggcctgggctgggttgtctggcgcagcgtcgac
gacctgcccgaagacctcatcttcaaggtcagctacctgggcggcgacatgcccaccttc
gcgctgaacttctcgcgtcccggcgctcaggtgctgctgcagtactacatgttcctgcgc
ctgggcatggacggcttccgccgcgtgcagacgaactcgcatgacgtggccaagttcctg
tcgagccagatcggcgccatggacgacttcgagctgtggaacgacggctccgatatcccg
gtgttcgcctggcggctgaaggatcgcccgaaccgcaagtgggatctttacgacctgtcg
gagcgcctgcgcacgcgcggctggttggtgcccgcctacccgatgccggccgacctcacc
gatgtcaccgtgcaacgcatcgtggtgcgcaatgggttgagccatgacctggccgacgcc
ttcctggagagcatgcgcgccgaggtggcctacctggacgccctgccggccccgatgccc
tcgcagcacaagcagtcgggcttccaccactga

DBGET integrated database retrieval system