KEGG   Pelosinus fermentans: JBW_02029Help
Entry
JBW_02029         CDS       T03813                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pft  Pelosinus fermentans
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pft00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    JBW_02029
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    JBW_02029
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    JBW_02029
Enzymes [BR:pft01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     JBW_02029
Peptidoglycan biosynthesis and degradation proteins [BR:pft01011]
 Precursor biosynthesis
  Amino acid ligase
   JBW_02029
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2336482..2337417
Genome map
AA seq 311 aa AA seqDB search
MKSKRIAVVMGGPSAEREVSLNTGKAILTALQESGYKGAVGIDLDPARFVEQLTKEKIEI
VFNAIHGQYGEDGVLQGALELLGIPYTGSGVLASAMAMDKGISKRIFLSASIPTPRSLLF
TKADLSRDLVTEIIAGFSIPVVVKSSSQGSSIGVVIVEESENLSQAIEQAFQYSDTILVE
EFIKGRELTVAIVGNNDLKALPVIEIVPFSGRYDYHSKYTKGTTEYIVPARLSEETTFLV
QKVALEAFHALRCSGIARVDIMLDEDDNPYVLEVNTIPGMTGTSLVPKAAAAAGISFSAL
CEELLCLVETK
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaagagcaaaagaattgcagtggtaatgggggggccatcagcggaaagagaggtttct
ttaaatacaggtaaagccattttaacagcacttcaggaaagcggatataaaggtgcagta
ggcattgatcttgatcctgcacgttttgtagaacagttaactaaagaaaaaattgaaatt
gtatttaatgcgattcatggtcaatacggtgaagatggagtattacaaggagcacttgaa
ttgttaggaatcccttataccgggtcaggagtgctagctagtgcgatggctatggataaa
ggaatctctaaaagaatatttttgtccgcctccattccaacacctcgttctcttttattt
acaaaagccgacttgagtcgtgatttagtaacagaaattattgctggttttagtataccc
gttgtagtaaaatcttcatctcaaggatctagtattggtgttgtcattgttgaagaaagt
gaaaatttgtctcaggcaattgaacaggctttccaatacagcgatactatcttagttgaa
gaatttataaaaggaagagaacttaccgttgcaatcgtaggtaataacgatttaaaggca
ttgcctgtgattgaaatagttcctttttcaggaaggtatgattatcattctaaatataca
aagggaaccactgaatatattgtgccagctcgattatcagaggaaaccactttccttgtg
caaaaagtggctttagaggcttttcatgcactaagatgctctggcattgcgagagtggat
atcatgcttgacgaggatgataatccttatgtgttagaagtgaatacgatacctggaatg
acaggtactagtttagtaccgaaagcagcagctgctgcaggaatatcatttagtgcatta
tgtgaggaattactgtgtctagtagagactaaataa

DBGET integrated database retrieval system