KEGG   Prevotella fusca: ADJ77_04190Help
Entry
ADJ77_04190       CDS       T04032                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
pfus  Prevotella fusca
Pathway
pfus00240  Pyrimidine metabolism
pfus01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfus00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    ADJ77_04190
Enzymes [BR:pfus01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     ADJ77_04190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK Ribosomal_L37e zf-dskA_traR
Motif
Other DBs
NCBI-ProteinID: AKU69029
UniProt: A0A0K1NIX8
LinkDB All DBs
Position
1:1026006..1026605
Genome map
AA seq 199 aa AA seqDB search
MTKIDNLNGERRRQGRIEVICGSMFSGKTEELIRRMKRAKFAKQKVEIFKPSIDTRYSDE
DVVSHDQNTIHSTPIDSSGNILLLASDIDVVGIDEAQFLDEGLTAVCNQLANNGIRVIIA
GLDMDYKGVPFGPIPALCAIADEVTKVHAICVKCGSLAYVSHRLIDDERRVMLGEQQEYE
PLCRECYQKATQKEENNKD
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagatagacaatcttaacggtgaaagacgtcgacaaggacgcattgaggtaatt
tgtggaagtatgttctctggcaagaccgaagaactcatccgacgtatgaaacgagcaaag
tttgcaaaacagaaggtggagatattcaaaccttccattgacacacgctactcggatgag
gatgtagtcagccatgaccagaacactattcattccacacctattgactcgtccggcaac
atccttcttcttgcatccgacattgatgtcgtgggcattgacgaggcacagtttctggac
gaaggacttactgccgtctgcaaccagctggctaacaacggcatccgtgtcatcattgcc
ggacttgacatggactacaaaggcgttcctttcggacctattcctgccctctgtgccatt
gccgacgaggtgacaaaggtacatgccatctgcgtgaagtgcggctcattggcttacgtg
agccatcgcctcattgacgacgaacgccgtgtcatgctcggcgaacagcaggaatacgaa
cctttatgccgtgaatgctaccagaaggcaacacagaaagaagaaaacaacaaagattaa

DBGET integrated database retrieval system