Pseudomonas fragi: AV641_20755 Help Entry AV641_20755       CDS       T04285                                  Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism pfz  Pseudomonas fragi Pathway pfz02024   Quorum sensing pfz03018   RNA degradation Brite KEGG Orthology (KO) [BR:pfz00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     AV641_20755  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     AV641_20755  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pfz03019]     AV641_20755    03036 Chromosome and associated proteins [BR:pfz03036]     AV641_20755 Messenger RNA biogenesis [BR:pfz03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      AV641_20755 Chromosome and associated proteins [BR:pfz03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     AV641_20755 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Gag_p24_C Motif Other DBs NCBI-ProteinID:  AMB81331 LinkDB All DBs Position complement(4616537..4616797) Genome browser AA seq 86 aa AA seqDB search MSKGHSLQDPYLNTLRKEKVGVSIYLVNGIKLQGTIESFDQFVILLKNTVSQMVYKHAIS TVVPVRPIRLPSAAESELADAEPGNA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgtcaaaagggcattcgctacaagacccttacttgaatactttgcgtaaagagaaggtt ggcgtttccatctacctggtcaacgggatcaagctgcaggggactatcgagtctttcgac cagttcgtgattctgctgaaaaacaccgtgagccaaatggtttacaaacacgctatctcg acagtcgtaccagtacgtcctattcgtctgccaagcgcagctgaatcggaactggcagac gctgaaccaggtaacgcctga

DBGET integrated database retrieval system