KEGG   Photobacterium gaetbulicola: H744_2c1287Help
Entry
H744_2c1287       CDS       T03698                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
pgb  Photobacterium gaetbulicola
Pathway
pgb00240  Pyrimidine metabolism
pgb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgb00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    H744_2c1287
Enzymes [BR:pgb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     H744_2c1287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22
Motif
Other DBs
NCBI-ProteinID: AJR07966
UniProt: A0A0C5W8S3
LinkDB All DBs
Position
2:1351006..1351584
Genome map
AA seq 192 aa AA seqDB search
MAQMYFYYSAMNAGKSTTLLQSSFNYRERGMTPVIFTAAIDDRYGKGKVSSRIGLQEDAE
LFSTSDDLYARLQDMNATKKVDCVLIDECQFLTKVQVYQLTEVVDKLNIPVLCYGLRSDF
RGELFEGSRYLLAWADKLVELKTICHCGRKANMVIRQDASGKAIADGDQVEIGGNDRYVS
VCRKHYKEALGR
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggcccagatgtatttctattactcggcaatgaatgcgggtaagtcgacaacattattg
cagtcatcttttaattaccgcgagcgcggcatgacgccggtgattttcaccgctgcaatt
gatgaccgttacggtaaaggcaaggtcagttcgcgaattggtttgcaggaagatgctgag
ctgttcagtaccagcgatgatctgtatgctcgtctgcaggatatgaatgcgaccaagaaa
gttgactgtgtgctgattgatgaatgccaattcttgaccaaagtgcaggtgtaccaatta
accgaagtcgtcgacaagctgaatattccggtgctttgctatggcttgcgcagtgacttt
cgtggtgagctgtttgaaggcagccgttatttgctcgcgtgggcagataaattggtagaa
ttgaaaactatttgccattgtggtcgtaaagccaatatggtgatccgtcaagatgccagc
ggcaaggcgattgctgacggcgaccaggtcgaaatcggcggcaatgaccgctatgtttcg
gtgtgccgcaagcactataaagaggcgcttggccgttag

DBGET integrated database retrieval system