KEGG   Phaeobacter gallaeciensis DSM 26640: Gal_03329Help
Entry
Gal_03329         CDS       T02968                                 

Definition
(GenBank) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pgd  Phaeobacter gallaeciensis DSM 26640
Pathway
pgd00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:pgd00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Gal_03329
Enzymes [BR:pgd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Gal_03329
Transporters [BR:pgd02000]
 Other Transporters
  Pores ion channels [TC:1]
   Gal_03329
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C GST_C_2 Flavi_M
Motif
Other DBs
NCBI-ProteinID: AHD11048
UniProt: V9WLI7
LinkDB All DBs
Position
3381558..3382172
Genome map
AA seq 204 aa AA seqDB search
MQLYYAPKTISVAVAIALEEAGLDYEPIRIDFAAKEQLGDAYAQINPKGRVPALVVDGGI
LTETGALLEYVADVAPDAGLRPKDPVLLARMREVMFYLASTMHVNHAHKLRGSRWATERS
SWKDMQKMVPQTMAASCDYICQSGLRGPLVLGDTLSLADCYLYVVCSWLEGDGVNVANYP
KIQKFMATMDQRESIRAVTAKGML
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgcagctatattacgcacccaagacgatttcggtggccgtggccattgcgctggaagag
gccggactggactatgaacccattcgcatcgactttgctgccaaggagcaacttggcgac
gcctacgcccagatcaaccccaagggccgcgtgccagcattggtcgtcgatggcggtatt
ctgaccgagaccggcgcgctgctggaatatgtagccgacgtggccccggacgctggcctg
cgccccaaggatcccgtgctgctggcacgcatgcgcgaggtgatgttctatctcgcatca
accatgcatgtgaaccacgcccacaagctgcgcggcagccgctgggccacggagcgcagc
agctggaaagatatgcagaagatggtgccccagaccatggcggcttcctgcgactatatc
tgccagtctggcctgcgcggccccttggtgctgggtgacacgctcagtctcgccgattgc
tatctctatgtggtgtgcagctggctggaaggcgacggggtcaatgtcgcgaactacccc
aaaattcagaaattcatggcgaccatggatcagcgcgagtccattcgcgccgtgaccgcc
aagggcatgctgtaa

DBGET integrated database retrieval system