KEGG   Porphyromonas gingivalis ATCC 33277: PGN_1578Help
Entry
PGN_1578          CDS       T00714                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
pgn  Porphyromonas gingivalis ATCC 33277
Brite
Translation factors [BR:pgn03012]
 Eukaryotic Type
  Elongation factors
   PGN_1578
 Prokaryotic Type
   PGN_1578
Mitochondrial biogenesis [BR:pgn03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    PGN_1578
Exosome [BR:pgn04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PGN_1578
  Exosomal proteins of breast cancer cells
   PGN_1578
  Exosomal proteins of colorectal cancer cells
   PGN_1578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1768507..1769694)
Genome map
AA seq 395 aa AA seqDB search
MAKEHFNRSKPHVNVGTIGHVDHGKTTLTAAITTVLAKRGLSELRSFDSIDNAPEEKERG
ITINTSHVEYQTANRHYAHVDCPGHADYVKNMVAGAAQMDGAIIVVAATDGPMPQTREHI
LLARQVNVPRLVVFMNKCDMVDDEEMLELVEMDMRELLSFYDFDGDNTPIIRGSALGALN
GEPQWEDKVMELMEAVDNWVPLPERDIDKPFLMPVEDVFSITGRGTVATGRIETGIVKTG
DEVQIIGLGAEGMKSVVTGVEMFRKILDEGQAGDNVGLLLRGIDKDQIKRGMVISHPGKI
TPHKRFKAEVYILKKEEGGRHTPFHNKYRPQFYIRTLDVTGEITLPEGTEMVMPGDNVTI
TVELIYPVACNVGLRFAIREGGRTVGAGQITELID
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagagcattttaacagatcgaaaccccacgttaacgttggtacgatcggacac
gtggaccacggtaagactaccttgacggctgcaatcacaactgtgttggcaaagaggggc
ctttcagaactccgttcatttgattcaatcgataacgctcccgaagaaaaggaacgtggt
atcacgattaatacttcacacgttgaataccaaacagctaatcgtcactacgctcacgta
gactgtccgggtcacgccgactatgtgaagaacatggttgccggtgctgctcagatggac
ggtgctataatcgttgtagcagctacagacggtcctatgcctcagactcgcgagcacatc
cttttggctcgccaggtaaacgttcctcgtctggttgttttcatgaacaaatgtgacatg
gtagacgatgaagagatgctcgagcttgttgaaatggacatgcgcgaactcctttctttc
tacgatttcgatggtgacaatacccctatcatccgtggttctgctctgggcgctttgaat
ggagagcctcagtgggaagacaaggtgatggagcttatggaagctgttgacaactgggtt
cccctgcctgagcgcgatatcgacaaaccgttcttgatgccggttgaagacgtgttctct
atcacgggtcgtggtacggtcgctacaggacgtatcgaaaccggtattgtgaagaccggt
gacgaagttcaaatcatcggcctcggtgcagaaggaatgaagtcggttgttacgggtgtt
gaaatgttccgtaagattcttgacgaaggtcaggctggtgacaacgttggtctcctcctg
cgtggtatcgataaggatcagatcaagcgtggtatggttatctctcacccgggtaagatt
actcctcacaagagatttaaggccgaggtttatatcttgaagaaagaagaaggtggtcgc
cacactcctttccacaacaaatatcgtccgcagttctacatccgtacgcttgacgtgacc
ggtgaaatcactcttcccgaaggaacagaaatggttatgcccggtgacaacgtaacgatc
actgtagaactcatctacccggttgcatgtaatgtaggtctccgcttcgctatccgtgaa
ggtggtcgtacggtaggtgccggtcagattacagagctcatcgactaa

DBGET integrated database retrieval system