KEGG   Puccinia graminis: PGTG_20780Help
Entry
PGTG_20780        CDS       T02226                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SETD1
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
pgr  Puccinia graminis
Pathway
pgr00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:pgr00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    PGTG_20780
Enzymes [BR:pgr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     PGTG_20780
Chromosome and associated proteins [BR:pgr03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     PGTG_20780
   HMT complexes
    COMPASS/SET1 complex
     PGTG_20780
    COMPASS/SET1 complex (yeast)
     PGTG_20780
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET N-SET RRM_1 SET_assoc
Motif
Other DBs
NCBI-GeneID: 13541426
NCBI-ProteinID: XP_003890756
UniProt: H6QP87
LinkDB All DBs
AA seq 1502 aa AA seqDB search
MEDEEKKRKKKDEEQKDEEQKTLSLPTLTLDPPTQDKSNYRCKYDPALDTSLVKKSAGPL
YRHSKPALLIKPNPNRDPRLKLAYPSPLSTHPTTPSGRSALIAGLSRSSRTRQAFHSRVE
LIPSYPYDRNSLGPPPPPPPSAILITMLDKLVTGEQVRSHFSQFGRIAECEIKLDPQTGG
SLGICWLRFLNQITHPTAESRHSSSSQTPTISSISNKNNRDQQDGHQSALAAVKKANGAR
IGCMLNMGPAPTSSSASRRLSTSNKLQHYGIRCQLDGQGKKCEQAVAEQLDLLYPPLPPP
PPLQDLSPSPLPPPPLQLDSHLSPAPTNQPLLPSPSHQPSTVTSSSHPSVPAPNHLTPQH
LELESEISKRISTSITLAPSPHPINHLSQSTPHHIPTSINQLTGSDSHALHLNDQAFLPS
EIDPSSQSSLPPPPPQAALAHPPTIPSAMRHRDYSQLPSSSTRHLSTPSVKSKIPESSHL
SSSLTSSKMPMVLKTSHYIKQGHVASSSTRSKIAAGFVAAAQTAAITAAKKAGLKLSSHE
QTEEHRRSGSRDRRGGRRSRSSSTDSRPYIPKSGSSKSGSDDSESESEDEDAREERQKEE
AREELIQSRTFHRPGRPDLRPTTTYKPSIPRPSLPGLSLLWPHNHIGIDKSIKIEILKRL
SLNHFSFLTINRVHLAEVQERCKVFYGQAELKEYFSKFQPDQIMTDGQMWYITFLTPNNA
QLSYAYIHSSSYVGTKLPIEVHEPITPQYFRELVDNNMQPLPVRRRCNDDEPSDRRPAQE
RADDVDQERRQVVVEEIEKKQKIDSRPKHDDSDRADRSIESKPQADLQRLAIISAPQPPL
RTLGHPSSWENNPDQRSAILKLPSFSKRKSSQSVTKNSSQSRSHDNTNPAPPGGIKKDNL
SRQSLIEDDESIETTGRASSHKQAIEDDDFASIASSDVNQPRRRRPNSTRESRPPVQETV
PSSSPTHAISDEESDKRPSYPANPPPRPIKKRVVQPAKKRRFQKVAFTSSEEEEAEEEKK
DQPPKNKKWKRAQLATEKDEKTQTVVEVPPCPEEPKVTVDEIILDSPIGVSAPSPRAPGT
LDSLAESEVPPTESILEVKPRRNKKVRLSAQARSSTKKAQNGRMVVDEEQAVPRLEEVAE
DAEDLYFVKLALSRSRSGRSLHPPITQKPKATDASNQPLDRNRKVGQDRSIVHWQRRARK
SSSPSLKAGSECEAEQEEEEAQSESKGKANEGVGRHSTGSSRTEGYYHISSSQKAIYLPQ
RNKAIIDLGSLAPATATTATTTTVSNPTQFSALALSRSTRVNSRRFILNMEQNKKASILS
SGNNPANDSLDSSLQLQANPNPAPSLDSVADVLKFNQLRTRKKQLKFSRSPIHDWGLYAM
ETIPAGEMVIEYVGEVIRQAVADRREKLYERMGIGSSYLFRVDDDLVVDATKKGNLGRLI
NHCCSPNCTAKIITINGEKKIVIYAKVTIELGDEVTYDYHFPKEEVKIPCLCGSVKCKGT
LN
NT seq 4509 nt NT seq  +upstreamnt  +downstreamnt
atggaagacgaggagaagaagaggaagaagaaggacgaggaacagaaggacgaggaacag
aaaacactctcactacccaccctcacactcgatccacccactcaagacaaatctaactat
cgatgcaagtatgatcctgccctggataccagtctcgtcaagaagagcgctggtccactc
taccggcactcaaaaccagcactgctcatcaaaccaaacccaaaccgagacccacgactc
aaattggcctacccctctccactatctactcatccaaccaccccttctggtcgttcagcc
ctcatcgccggcctatcccgttcatcccgtaccaggcaggccttccattcgagggtcgaa
ctaataccatcctatccctacgatcgaaacagtctcggcccccctccccctccaccccca
tcagcgatcctgatcaccatgttagataaactggtcaccggcgaacaggtgcggagtcat
ttctctcagtttggcaggattgccgaatgtgagatcaaactggaccctcaaacaggtggc
tccctgggtatctgctggctacgattcctcaatcaaatcactcatcctaccgctgaatct
cgtcacagttcatcctctcaaactccgaccatcagcagtatcagcaacaagaacaatcga
gaccaacaggatggtcatcaatctgcactcgctgccgtcaaaaaggccaatggggctagg
atcggctgtatgttgaacatgggcccggcccccactagctcatctgcttccaggcgactt
tcaacatcaaacaaactgcagcattacggtatccgatgtcaactcgatggtcaaggtaaa
aaatgtgaacaggccgtcgccgaacaactcgatctactctatccccctctaccacctcca
cctccactccaagacctcagcccttcacccctaccaccacctcccctacagctcgattct
catctctccccagcccccaccaaccaaccgctgctaccctcaccttcacaccaaccatcc
actgtgactagctcatcccatccgtcagttccagcccctaatcatctcactcctcaacat
cttgaacttgaatctgaaatttcgaagcgaatatcaacctctatcacccttgccccctcc
cctcatccgataaaccatctttcacagtcaacccctcatcatattccgacttcaatcaat
cagctcactggatcagacagtcatgctcttcacttaaacgatcaggccttcttaccttca
gaaattgaccccagctctcaatcatcactgccaccaccaccacctcaggcggctctagcc
cacccacccacgattccctcagccatgcgccacagagattactctcagctaccttcttcc
tcgactcgacatctatccaccccatcagtcaaatctaagatcccagaatcatcacatctt
tcatcgagtctgaccagttccaagatgcccatggtcctcaagaccagtcattacatcaaa
cagggccatgtggctagctcatcaactcgtagcaaaattgccgctgggtttgttgcggca
gcccaaaccgcagcgatcacggccgcgaagaaagcaggtctcaagctatcctctcacgag
caaacagaggagcacagaaggtcgggttccagggaccgtcgtggaggtcggaggagtcgg
tcgagtagcacggattcgaggccgtacattccgaaaagtggcagttcaaagagcggctca
gatgattccgaatcggagagtgaagatgaggatgcgcgagaagagagacagaaggaagag
gcccgcgaagagctgattcagagtcgcactttccaccgtcctggtcgaccagatctcaga
cctacaacaacctacaaaccatcaatacctcgtccatccctacccggactatccttacta
tggcctcacaatcatatcgggatcgataaatcaatcaaaatcgagatcttgaagcgactc
tcactcaatcacttcagctttttgaccattaatcgtgtccatttggccgaagttcaggaa
cgatgtaaggtcttctacggacaggctgaactgaaagaatacttctcgaaattccaaccc
gaccagatcatgaccgacgggcagatgtggtacattacgttcctgactcccaacaacgca
caattgtcatacgcgtacatccactcatcaagctacgtgggtaccaagttgccgatcgaa
gttcacgaaccgattactccgcagtactttcgagagttggtagacaacaacatgcaacct
ttgccagtccgaagaaggtgcaatgatgatgagcctagtgatcgtcggcccgcacaagag
agagcagatgatgttgatcaagaaagaaggcaagtagttgtggaagagatagagaagaag
caaaaaatcgacagccggcctaagcacgatgattccgaccgggccgatcggtcaattgaa
agtaaacctcaggcagatcttcaaagactggctatcatcagcgctcctcaacctcctctg
cgaactctgggacatccaagttcttgggaaaacaacccagatcaacgatcagcaatttta
aaattgccatcattttcgaaacggaaatcctctcaatccgtcaccaagaattccagccaa
tcaagatctcatgacaataccaacccggctccccctggtggtataaagaaggataatttg
agcaggcaatctctgattgaagatgacgagtcaattgaaaccaccggcagagcctcgtca
cacaaacaggcgatcgaagatgatgattttgcatcaattgcctcttccgacgtcaaccag
cctcgccgacgcagacctaacagtactcgagagtcacgcccacccgtgcaggagactgtt
ccatcatcatctcccacacatgccatttcggatgaagaatcagataaaaggcctagctac
ccagccaatccgccaccgagaccgatcaagaagcgggtcgtccagcccgccaaaaaacgg
cggttccagaaagtagcatttacgagtagtgaggaggaggaagcagaagaagaaaagaag
gatcagccacccaaaaataagaagtggaaacgcgctcagttggctactgaaaaagatgag
aagactcaaacggtggtcgaggtcccaccttgtcctgaggagcccaaagtgacggtggat
gagatcatcctcgattctcccattggcgtctcggcaccgtctcccagagcccctggaacc
ttagattcattggcagagagcgaggtaccgccaactgaaagcatactggaagtcaaaccg
aggcggaacaagaaagttcgtctatcagcccaagcccgatcatcaacaaagaaggctcag
aatgggcgtatggtggtagatgaggaacaagcagttccgaggctcgaagaggtagccgag
gacgcagaggatctatactttgttaaattggcgttgagcaggtcgaggtccggccgaagt
cttcatccaccgatcacacagaaacctaaagcaacggacgcttctaaccaaccactcgat
cgaaacagaaaagtgggccaggatcggtcgatcgttcattggcagcgtagagcaaggaag
agcagttctcccagcttgaaagctggatcagaatgtgaagcagaacaagaagaagaggaa
gctcagagtgaatcgaaggggaaagcaaacgaaggtgtcggtagacattcaacaggttca
tcacgcaccgagggatattatcacatctcctcttcccaaaaggcgatctatctgccccaa
agaaacaaggctatcatcgatctcggatccctcgcccccgcaacggccacgacggccacg
acgacgacggtcagcaatcccacccaattctcagcccttgccctgtccaggtccacccgt
gtcaattcgcgaagattcatcctcaacatggaacagaataagaaagctagcatcctctct
tccggaaacaatcccgccaacgactcactcgactcgtctcttcaactccaagccaatcct
aatcctgctccctcactcgactcggttgccgatgtgctcaaattcaatcagctgaggact
aggaaaaaacagttgaagttctcgagatcacctatccatgattggggattatatgcaatg
gagactatcccagcaggagagatggtgatcgagtatgtgggagaagtgatcagacaggcg
gttgctgatcgacgggagaagctatacgagcggatggggatcggatcgagttatctgttt
agagtcgacgacgacttggttgttgatgccaccaagaaaggaaacctggggaggttgatc
aatcattgttgtagtcctaactgcaccgctaaaatcatcacgatcaatggagagaagaaa
attgtgatctatgccaaagtgaccatcgaactgggtgatgaagtgacatacgactatcac
ttcccaaaggaagaggtcaagatcccatgtctgtgtggctcagtaaaatgcaaaggaact
ctgaattga

DBGET integrated database retrieval system