KEGG   Porphyromonas gingivalis TDC60: PGTDC60_0407Help
Entry
PGTDC60_0407      CDS       T01516                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pgt  Porphyromonas gingivalis TDC60
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pgt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PGTDC60_0407 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    PGTDC60_0407 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PGTDC60_0407 (gpmA)
Enzymes [BR:pgt01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     PGTDC60_0407 (gpmA)
Exosome [BR:pgt04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   PGTDC60_0407 (gpmA)
  Exosomal proteins of melanoma cells
   PGTDC60_0407 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(436744..437490)
Genome map
AA seq 248 aa AA seqDB search
MKRIVLIRHGESLWNKENRFTGWTDVDLSEKGIEEAKKAGELMKKEGFQFTKAYTSYLKR
AVKTLNGVLDVMDLDWIPVEKTWRLNEKHYGMLQGLNKVETAEKYGDEQVLIWRRSYDVP
PTPMEKEDPRSPFMDPRYKGVCEKDLPLTEALCDTVNRILPYWNETIFPTLKEHDEVLVA
AHGNSLRGIIKVLKNISDEDIISLNLPTAVPYVFEFDDNLRLVKDYFLGDPEEIKKLMEA
VANQGKKK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaatagtattgattcgccacggcgaaagcttgtggaacaaggaaaatcgcttt
acgggatggacagatgtggatttgtccgaaaaaggtattgaagaagccaagaaagccggc
gaactcatgaagaaagaaggttttcagtttaccaaagcctatacttcctatctcaaacgt
gccgtcaagaccctgaacggtgtcctcgatgtaatggacttggattggataccggtggag
aagacctggcgtctgaacgagaagcactacggcatgctgcaaggcctcaacaaggtcgag
actgccgagaagtacggggacgagcaggtactcatctggcgtcgcagctacgacgttccc
cccacgcctatggagaaagaggatccgcgctctccgttcatggatccgcgctacaaaggt
gtgtgcgagaaagacctgccactgacagaagctctctgcgacacggtaaatcgtatcctc
ccctattggaacgagaccatattccctacactcaaggagcatgacgaggtattggtagcg
gctcacggcaacagtctgcgtggtatcatcaaggtgctgaaaaacatttcggacgaagac
atcatcagcctgaacctcccgacagccgtgccttacgtttttgaatttgacgacaatctc
cgtctggtgaaggactatttcctcggcgatcccgaagagatcaaaaagctgatggaggca
gtagccaatcagggcaagaagaaataa

DBGET integrated database retrieval system