KEGG   Polymorphum gilvum: SL003B_2411Help
Entry
SL003B_2411       CDS       T01458                                 

Definition
(GenBank) Alanine racemase, biosynthetic
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
pgv  Polymorphum gilvum
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pgv00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    SL003B_2411
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    SL003B_2411
Enzymes [BR:pgv01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     SL003B_2411
Peptidoglycan biosynthesis and degradation proteins [BR:pgv01011]
 Precursor biosynthesis
  Racemase
   SL003B_2411
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2566924..2568171
Genome map
AA seq 415 aa AA seqDB search
MSRPQRLRIGYDWICLATARDSPRFRTNAGAWVLPMSSVSPEALAGGVLTVDTAAIADNW
RALAGQLGPGARCAATVKADAYGCGIPATVRALAASGCDTFFVALPAEGIAVREAAPGAT
IYVLDGLFPGTAPAYAEARLRPVLGSLPELEEWALFCRSRKVRLEAAVHVDTGMNRLGLT
EQEAERLAGDRDLLDSFALALVISHLACGAEPGHPLNRQQLERFRTLSGHFPDAVRSLAN
SAGIFLGADYHFDLVRPGIALYGGKALDSFDNPMRPVARVEARILQLRTVRAGEGVGYGL
AQTVRRDTRLAVVAAGYADGLLRRAGGSDDRPGGHGWIVGHRVPVFGRISMDMQALDVTD
VPAALLRRGAMVELIGPHVAASELAAVADTIDYEYLTALGRRFHRRYAPLAEVAG
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgtctcggccacagcggcttcgcatcggctatgattggatttgtctcgcgactgcgcgc
gattcgcctcgatttcgaaccaatgccggggcatgggtcctgccgatgagttccgtatcc
ccagaagccctcgccggcggcgtgctgaccgtcgacactgcggcgatcgccgacaactgg
cgcgcactcgccggccaactcgggccgggcgcgcgctgcgccgcgaccgtcaaggccgac
gcctacggttgcggcattccggcgaccgtgcgcgcgcttgccgccagcggctgcgacacg
ttcttcgtcgcccttcccgccgagggaatcgccgttcgcgaggccgctccgggagcgacg
atctacgttctcgacggtctgtttcccggcacggcaccggcctatgccgaggcgcgcctg
cgcccggtgctcggctcgctccccgagctggaggaatgggcgctgttctgccgcagccgc
aaggtccggctcgaggcggcggtgcatgtcgacaccggcatgaaccggctcggcctgacc
gagcaggaagccgagcggctcgccggcgaccgcgacctgctcgactccttcgctctggct
ctggtcatcagccacctcgcctgcggcgccgagcccggacatccgctcaacaggcagcag
ttggagcggttcaggacactttcaggacactttccggacgccgtcaggtcgctggccaat
tccgccggtatcttcctcggcgccgactaccatttcgacctggtccgcccggggatcgcg
ctctacggcggcaaggccttggattcctttgacaatccgatgcggcccgtggccagggtg
gaggcgcggatcctgcagctgcgcaccgtgcgggccggcgagggcgtcggctacggcctc
gcccagacggtgcgccgcgacacccgtctggccgtcgtcgcggccggctatgccgatgga
ctgctgcgccgcgccggcggcagcgacgaccgtcctggcggccacggctggatcgtcggg
caccgggtgccggttttcgggcgcatctcgatggacatgcaagcccttgatgtgactgat
gttcccgccgccctgctgcgccggggcgcgatggtcgaactgatcggtccgcatgtcgcg
gcgagcgaactggcggccgtggccgacaccatcgactatgaatatctcaccgcgctcggc
cgccgcttccaccgccgctacgcgcccctggcagaggttgccggctga

DBGET integrated database retrieval system