KEGG   Phyllostomus hastatus (greater spear-nosed bat): 123812406
Entry
123812406         CDS       T07912                                 
Symbol
KRAS
Name
(RefSeq) GTPase KRas isoform X1
  KO
K07827  GTPase KRas
Organism
phas  Phyllostomus hastatus (greater spear-nosed bat)
Pathway
phas01521  EGFR tyrosine kinase inhibitor resistance
phas01522  Endocrine resistance
phas04010  MAPK signaling pathway
phas04012  ErbB signaling pathway
phas04014  Ras signaling pathway
phas04015  Rap1 signaling pathway
phas04062  Chemokine signaling pathway
phas04068  FoxO signaling pathway
phas04071  Sphingolipid signaling pathway
phas04072  Phospholipase D signaling pathway
phas04137  Mitophagy - animal
phas04140  Autophagy - animal
phas04150  mTOR signaling pathway
phas04151  PI3K-Akt signaling pathway
phas04210  Apoptosis
phas04211  Longevity regulating pathway
phas04213  Longevity regulating pathway - multiple species
phas04218  Cellular senescence
phas04360  Axon guidance
phas04370  VEGF signaling pathway
phas04371  Apelin signaling pathway
phas04540  Gap junction
phas04550  Signaling pathways regulating pluripotency of stem cells
phas04625  C-type lectin receptor signaling pathway
phas04650  Natural killer cell mediated cytotoxicity
phas04660  T cell receptor signaling pathway
phas04662  B cell receptor signaling pathway
phas04664  Fc epsilon RI signaling pathway
phas04714  Thermogenesis
phas04720  Long-term potentiation
phas04722  Neurotrophin signaling pathway
phas04725  Cholinergic synapse
phas04726  Serotonergic synapse
phas04730  Long-term depression
phas04810  Regulation of actin cytoskeleton
phas04910  Insulin signaling pathway
phas04912  GnRH signaling pathway
phas04914  Progesterone-mediated oocyte maturation
phas04915  Estrogen signaling pathway
phas04916  Melanogenesis
phas04917  Prolactin signaling pathway
phas04919  Thyroid hormone signaling pathway
phas04921  Oxytocin signaling pathway
phas04926  Relaxin signaling pathway
phas04929  GnRH secretion
phas04933  AGE-RAGE signaling pathway in diabetic complications
phas04935  Growth hormone synthesis, secretion and action
phas04960  Aldosterone-regulated sodium reabsorption
phas05010  Alzheimer disease
phas05022  Pathways of neurodegeneration - multiple diseases
phas05034  Alcoholism
phas05160  Hepatitis C
phas05161  Hepatitis B
phas05163  Human cytomegalovirus infection
phas05165  Human papillomavirus infection
phas05166  Human T-cell leukemia virus 1 infection
phas05167  Kaposi sarcoma-associated herpesvirus infection
phas05170  Human immunodeficiency virus 1 infection
phas05200  Pathways in cancer
phas05203  Viral carcinogenesis
phas05205  Proteoglycans in cancer
phas05206  MicroRNAs in cancer
phas05207  Chemical carcinogenesis - receptor activation
phas05208  Chemical carcinogenesis - reactive oxygen species
phas05210  Colorectal cancer
phas05211  Renal cell carcinoma
phas05212  Pancreatic cancer
phas05213  Endometrial cancer
phas05214  Glioma
phas05215  Prostate cancer
phas05216  Thyroid cancer
phas05218  Melanoma
phas05219  Bladder cancer
phas05220  Chronic myeloid leukemia
phas05221  Acute myeloid leukemia
phas05223  Non-small cell lung cancer
phas05224  Breast cancer
phas05225  Hepatocellular carcinoma
phas05226  Gastric cancer
phas05230  Central carbon metabolism in cancer
phas05231  Choline metabolism in cancer
phas05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
phas05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:phas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    123812406 (KRAS)
   04012 ErbB signaling pathway
    123812406 (KRAS)
   04014 Ras signaling pathway
    123812406 (KRAS)
   04015 Rap1 signaling pathway
    123812406 (KRAS)
   04370 VEGF signaling pathway
    123812406 (KRAS)
   04371 Apelin signaling pathway
    123812406 (KRAS)
   04068 FoxO signaling pathway
    123812406 (KRAS)
   04072 Phospholipase D signaling pathway
    123812406 (KRAS)
   04071 Sphingolipid signaling pathway
    123812406 (KRAS)
   04151 PI3K-Akt signaling pathway
    123812406 (KRAS)
   04150 mTOR signaling pathway
    123812406 (KRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    123812406 (KRAS)
   04137 Mitophagy - animal
    123812406 (KRAS)
  09143 Cell growth and death
   04210 Apoptosis
    123812406 (KRAS)
   04218 Cellular senescence
    123812406 (KRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    123812406 (KRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    123812406 (KRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    123812406 (KRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    123812406 (KRAS)
   04650 Natural killer cell mediated cytotoxicity
    123812406 (KRAS)
   04660 T cell receptor signaling pathway
    123812406 (KRAS)
   04662 B cell receptor signaling pathway
    123812406 (KRAS)
   04664 Fc epsilon RI signaling pathway
    123812406 (KRAS)
   04062 Chemokine signaling pathway
    123812406 (KRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    123812406 (KRAS)
   04929 GnRH secretion
    123812406 (KRAS)
   04912 GnRH signaling pathway
    123812406 (KRAS)
   04915 Estrogen signaling pathway
    123812406 (KRAS)
   04914 Progesterone-mediated oocyte maturation
    123812406 (KRAS)
   04917 Prolactin signaling pathway
    123812406 (KRAS)
   04921 Oxytocin signaling pathway
    123812406 (KRAS)
   04926 Relaxin signaling pathway
    123812406 (KRAS)
   04935 Growth hormone synthesis, secretion and action
    123812406 (KRAS)
   04919 Thyroid hormone signaling pathway
    123812406 (KRAS)
   04916 Melanogenesis
    123812406 (KRAS)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    123812406 (KRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    123812406 (KRAS)
   04726 Serotonergic synapse
    123812406 (KRAS)
   04720 Long-term potentiation
    123812406 (KRAS)
   04730 Long-term depression
    123812406 (KRAS)
   04722 Neurotrophin signaling pathway
    123812406 (KRAS)
  09158 Development and regeneration
   04360 Axon guidance
    123812406 (KRAS)
  09149 Aging
   04211 Longevity regulating pathway
    123812406 (KRAS)
   04213 Longevity regulating pathway - multiple species
    123812406 (KRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    123812406 (KRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    123812406 (KRAS)
   05206 MicroRNAs in cancer
    123812406 (KRAS)
   05205 Proteoglycans in cancer
    123812406 (KRAS)
   05207 Chemical carcinogenesis - receptor activation
    123812406 (KRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    123812406 (KRAS)
   05203 Viral carcinogenesis
    123812406 (KRAS)
   05230 Central carbon metabolism in cancer
    123812406 (KRAS)
   05231 Choline metabolism in cancer
    123812406 (KRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    123812406 (KRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    123812406 (KRAS)
   05212 Pancreatic cancer
    123812406 (KRAS)
   05225 Hepatocellular carcinoma
    123812406 (KRAS)
   05226 Gastric cancer
    123812406 (KRAS)
   05214 Glioma
    123812406 (KRAS)
   05216 Thyroid cancer
    123812406 (KRAS)
   05221 Acute myeloid leukemia
    123812406 (KRAS)
   05220 Chronic myeloid leukemia
    123812406 (KRAS)
   05218 Melanoma
    123812406 (KRAS)
   05211 Renal cell carcinoma
    123812406 (KRAS)
   05219 Bladder cancer
    123812406 (KRAS)
   05215 Prostate cancer
    123812406 (KRAS)
   05213 Endometrial cancer
    123812406 (KRAS)
   05224 Breast cancer
    123812406 (KRAS)
   05223 Non-small cell lung cancer
    123812406 (KRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    123812406 (KRAS)
   05170 Human immunodeficiency virus 1 infection
    123812406 (KRAS)
   05161 Hepatitis B
    123812406 (KRAS)
   05160 Hepatitis C
    123812406 (KRAS)
   05163 Human cytomegalovirus infection
    123812406 (KRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    123812406 (KRAS)
   05165 Human papillomavirus infection
    123812406 (KRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    123812406 (KRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    123812406 (KRAS)
  09165 Substance dependence
   05034 Alcoholism
    123812406 (KRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    123812406 (KRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    123812406 (KRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    123812406 (KRAS)
   01522 Endocrine resistance
    123812406 (KRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:phas04131]
    123812406 (KRAS)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:phas04031]
    123812406 (KRAS)
Membrane trafficking [BR:phas04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    123812406 (KRAS)
GTP-binding proteins [BR:phas04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    123812406 (KRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 FeoB_N Septin
Other DBs
NCBI-GeneID: 123812406
NCBI-ProteinID: XP_045685031
LinkDB
Position
Unknown
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC
VKIKKCIVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgaatataaacttgtggtagtgggagctggtggcgtaggcaagagtgccttgacg
atacagctaattcaaaatcactttgtggatgaatatgatcctacaatagaggattcctac
aggaaacaagtagtaattgatggagaaacctgtctcttggatattctcgacacagcaggt
caagaggagtacagtgcaatgagggaccagtacatgaggactggggagggctttctttgc
gtatttgccataaataatactaaatcatttgaagatattcaccattatagggaacaaata
aaaagagttaaagactctgaagatgtacctatggtcctagtaggaaataaatgtgacttg
ccttctagaacagtagacacaaaacaggctcaggatttagcaagaagttatggaattcct
tttattgaaacatcagcaaagacaagacagagagtggaggatgctttttatacattggtg
agagagatccgacaatacagattgaaaaaaatcagcaaagaagaaaagactcctggctgt
gtgaaaattaaaaaatgcattgtaatgtaa

DBGET integrated database retrieval system