KEGG   Pedobacter heparinus: Phep_0802Help
Entry
Phep_0802         CDS       T00978                                 

Definition
(GenBank) Thymidine kinase
  KO
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
phe  Pedobacter heparinus
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phe00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Phep_0802
Enzymes [BR:phe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Phep_0802
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(949947..950528)
Genome map
AA seq 193 aa AA seqDB search
MLFSEQNYRRGEYCGSIEVICGSMFSGKTEELLRRLKRAQIAKLNVEIFKPKTDTRYDET
AVVSHDLNSIQSTPVENSAAILLLGANTQVVGIDEAQFFDDNLPEVCNKLAQKGIRVIVA
GLDMDFQGKPFGPVPALMAIAELVTKVNAVCVRCGSPAVYSYRTAASESTILLGEKDSYE
PRCRHCYHLGDMA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgttattcagcgaacaaaattacaggcggggtgagtattgcggcagcattgaagtgatt
tgtggctctatgttttcgggtaagaccgaagaattgttaagaaggctaaaacgtgcgcag
attgctaaactgaatgtagagatctttaaacccaaaacagatacccgctatgatgaaacc
gctgtagtttcgcacgatctgaattccatccagtctacaccggtcgaaaactctgctgca
attctgctgctgggtgccaatacacaggttgttggtattgatgaagcacagttttttgat
gataacctgcctgaagtttgtaataaacttgcccagaaagggatcagggtaatcgttgct
ggtctcgatatggactttcagggcaaaccttttggcccagtacccgcattaatggctatt
gccgagctggtaaccaaggtaaatgcagtatgtgtacgttgtggaagtccggctgtatac
tcttaccgtacagctgccagtgaaagtacgatcctgctaggcgaaaaggacagttatgaa
cccaggtgcaggcattgctatcatttgggcgacatggcttag

DBGET integrated database retrieval system