KEGG   Pedobacter heparinus: Phep_4263Help
Entry
Phep_4263         CDS       T00978                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
phe  Pedobacter heparinus
Pathway
phe00620  Pyruvate metabolism
phe00680  Methane metabolism
phe01100  Metabolic pathways
phe01120  Microbial metabolism in diverse environments
phe01200  Carbon metabolism
Module
phe_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:phe00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Phep_4263
  Energy metabolism
   00680 Methane metabolism
    Phep_4263
Enzymes [BR:phe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Phep_4263
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ACU06454
UniProt: C6XXE8
LinkDB All DBs
Position
5140784..5143372
Genome map
AA seq 862 aa AA seqDB search
MMQKQRAKGQRESIFNNEVVSRFELYNSLFLTLPFYKVKDTGTLLPLFIKYCEDGINNHQ
TPATIIDAFFKKYTQNNSNKDIIDLLFRFIQYIERQVVLFDAVEDASFNKLNAADEHNAL
LSYLKKGIDNKALNDKIEKLIDEFSLRLVLTAHPTQFYPGSVLSIITDLTTALKTNDIST
INLLLQQLGKTPFFNKKSPTPVDEALSLAWYLENVFYFAAANIQSEIDKSLNDYNLESKK
IIELGFWPGGDRDGNPNVHTDSTIQVSKMLRQILFRCYYRDFRNLKRRITFRGVEEHIAI
VQDVLYKNAFDPNIETENIADFLIENLNNIRATLMDDHDGLFADLASDLIRKVELYGSHF
ASLDIRQDSRVLRDVHAFCRQRKPIISLFPENYDSLSEAEKIKALSFKSARINYSENKDS
LINDTLQTITEIKQIQESNGELACHRFIISNCQQASDILQLMELFLWNGWEETDLSIDFV
PLFETVHDLADAGGIMETLYAHPFYKKHLKRRGNKQHIMLGFSDSTKDGGYLMANWSIFN
AKVALTETANKHNIQLAFFDGRGGPPSRGGGKTHRFYASMGKEIANKNIQLTIQGQTISS
QYGSIDSAEFNIEQLINAGISAGIKETHNILLDPLHKELLDVMAKESYEAFVDLRKHPLF
LSYLEKFSPLSLLSKITISSRPVKRNSGGALKLEDLRAISFVTAWSQLKQNIPGFYGMGT
ALKNQEKLGNWDKVVKTYQESGYFKTIIDNCMMSMSKSDFAITAHFANDKEYGAFWKMLH
DEFELSKSMLLKLSGHETLMENYPVEKRSIAVREKIVLPLVLIQHYALERLQTEITAEEQ
QSYEKLAIRTVYGIVNAGRNLA
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atgatgcagaaacagcgagcaaaaggtcagagagagtctatatttaacaatgaggtcgta
tcccggttcgagctttacaatagtctttttcttacccttccgttttacaaggtgaaagat
accggtaccttattacccttatttattaaatactgtgaagatggcataaacaaccaccag
actccggcaactattattgatgctttttttaagaagtatacccaaaacaactcaaataaa
gacattattgacctcctgttccgctttatccagtacatagaacgtcaggtggtattgttt
gatgcggtagaagatgcttcatttaataaactgaatgccgctgatgagcacaatgccctg
ctgtcttaccttaaaaagggaatagacaacaaagccctgaacgataagatcgaaaaactc
attgacgagttttctttgcgcctggtgctcaccgcacaccccacccagttttaccctggc
agtgtactttctatcattacagacctcactacggcccttaaaaccaacgacatctctacc
ataaacctgttgttgcagcaattgggcaaaacaccttttttcaataaaaaatcaccaact
ccggttgatgaggccctaagcctggcctggtacctggaaaatgtattttactttgccgca
gccaacatacagtctgaaatagacaaaagccttaacgattataacctcgaatctaaaaag
atcatcgagctgggcttctggcctggtggcgaccgtgacggtaatccaaatgtacatacc
gattctaccatacaggtttcaaaaatgctgagacagatcctgttcaggtgttattaccgc
gatttcaggaacctgaaacgtcgcattaccttccgtggtgtagaagaacatattgccatt
gtacaggacgtattgtacaaaaacgcctttgatcccaatatagaaacggaaaacattgcc
gattttttaatcgaaaacctcaataacatccgggctacactgatggacgaccacgacggc
ctgtttgcagaccttgcctcagacctcatccgtaaggtagagctatatggcagtcatttt
gcctctctcgacatcagacaggacagccgtgtgctcagggatgtacatgccttctgccgt
cagcgcaaaccgatcatttctttattccctgaaaactacgacagcctttccgaagcggaa
aagatcaaggccctttcttttaaaagtgcgaggatcaattatagtgaaaacaaagattcc
ctgatcaatgataccctgcaaaccattacagagatcaaacagatccaggaaagcaacgga
gaactggcctgccaccgtttcatcatcagcaattgccagcaggccagcgatatcctgcag
ctgatggaacttttcctttggaacggctgggaagagacagacctttccatagattttgta
cccctctttgagactgtacatgatcttgccgatgctggagggattatggaaaccctgtac
gcccatcctttttacaaaaaacacctgaaaagaagaggcaataaacaacacatcatgctg
ggcttctccgacagtacaaaagacggaggttacctgatggccaactggtctatttttaac
gcaaaagtagctttaacagaaacggcaaataaacacaacatacaacttgccttttttgac
ggccgtgggggcccgccttcaaggggcggaggcaaaacacaccgtttttatgcctcgatg
ggtaaagagattgcgaacaaaaacatccagcttaccattcaaggccaaaccatcagttca
caatacggatctatcgatagtgctgagttcaacattgagcaactgatcaatgcaggaata
tctgccggcatcaaagaaacccataacatcctgctcgacccgctgcacaaggaactgctg
gatgtaatggcaaaagagagttatgaagcctttgtagacctgcgcaaacatcctttattt
ttaagctatctggaaaaattctctccgttaagccttctttcaaaaattaccatcagcagc
aggcctgtaaaacggaattccggaggggctttaaaactggaagacctcagggccatcagc
tttgtaaccgcatggagtcagttaaagcaaaacatacctggcttttatggcatgggcacg
gccctgaagaaccaggaaaaactgggcaactgggacaaggtggtaaaaacctatcaggaa
tcagggtatttcaaaaccatcatcgacaattgtatgatgtctatgagcaagtccgatttt
gccatcaccgcccactttgcaaacgacaaagaatacggggctttctggaaaatgctgcac
gatgaatttgagctgtccaaaagcatgctgctgaagctttcgggtcatgagactttaatg
gaaaattatcctgtagagaagcgctctattgccgtaagggagaaaattgtattgccattg
gtattgatccagcattatgccctggaaagattgcaaactgaaatcaccgctgaggaacaa
caatcttacgaaaagctggccatcagaactgtatatggtattgtaaatgccggacggaac
ctcgcttaa

DBGET integrated database retrieval system