KEGG   Pseudonocardia sp. HH130630-07: AFB00_19065Help
Entry
AFB00_19065       CDS       T04486                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
phh  Pseudonocardia sp. HH130630-07
Pathway
phh00564  Glycerophospholipid metabolism
phh01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:phh00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    AFB00_19065
Enzymes [BR:phh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AFB00_19065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 FAD_oxidored Pyr_redox_2 3HCDH_N Pyr_redox GIDA NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ANY08041
UniProt: A0A1B1ZQI9
LinkDB All DBs
Position
complement(4008687..4010399)
Genome map
AA seq 570 aa AA seqDB search
MKSVALSPEARTAALQAMGDRELDVLVVGGGVVGAGSALDAATRGLSVGLVEARDFASGT
SSRSSKLVHGGLRYLEMLDFRLVAEALAERGLLIQQLAPHLVRPVPFLYPLQHRGWERLY
AGAGVALYDTLGFLSGRSRGVPHHRHLTRRGARRVVPSLRKDALVGALQYYDAQVDDARH
TMFIARTAAAYGAHVATRARVVGLLKEAGRVVGATVQDLESGEQVDVRAKQVINATGVWT
DDTQGLAGERGLFKVRASKGIHLVVPRDRIRGESGLILRTEKSVLFVIPWGRHWIIGTTD
TGWDLDKAHPAASAADIDYLLQHVNTVLEQPLTHDDVEGVYAGLRPLLSGESESTSKLSR
EHAVATPVPGLVVVAGGKYTTYRVMAKDAVDAAVHGLDAKVPASCTAEVPLLGAEGYHAL
TNATANLARSSGLHPARIEHLLGRYGSLIQEVLDLAAADPTLTEPLAGAPDYLRAEVVYA
ASHESARHLEDILARRTRISIETFDRGVEATQEAARLVAPVLGWNDEQVEREVDHYRKRV
EAERESQRMPDDATADAARLGAPDVVPVSG
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcggtggcgctctccccggaggcccgtaccgcggcgctgcaggcgatgggcgac
cgcgaactcgacgtactcgtcgtcggcggcggtgtcgtcggcgccggctccgcgctcgac
gccgccacgcgcggcctgtcggtcggtctcgtcgaggcccgcgacttcgcctcgggcacg
tccagccgctcgtccaagctcgtccacggtggcctgcgctacctggagatgctggacttc
cgcctggtcgccgaggcactcgccgagcgcggcctgctcatccagcagctggccccgcac
ctggtccgcccggtcccgttcctctacccgctgcagcaccggggctgggaacggctctac
gccggcgccggcgtcgccctctacgacacgctcgggttcctgtccgggcgctcgcggggc
gtcccgcaccaccgccacctcacccggcgcggtgcccggcgggtcgtcccgtccctgcgc
aaggacgcgctggtgggcgccctgcaatactacgacgcccaggtcgacgacgcgcggcac
accatgttcatcgcgcgcaccgccgccgcctacggcgcgcacgtggcgacccgggcccgc
gtcgtcgggctgctcaaggaggccggccgggtggtcggcgccaccgtgcaggacctcgag
tccggcgagcaggtcgacgtccgtgccaagcaggtcatcaacgccaccggcgtgtggacc
gacgacacccagggcctggccggcgagcgcggcctgttcaaggtgcgggcttcgaagggc
atccacctcgtggtgccccgggaccggatccgcggcgagtccgggctgatcctgcgcacc
gagaagtcggtactgttcgtcatcccgtggggccggcactggatcatcggcaccaccgac
accggctgggacctggacaaggcgcacccggcggccagcgcggcggacatcgactacctg
ttgcagcacgtcaacacggtcctggagcagccgctgacgcacgacgacgtcgagggcgtc
tacgcgggcctgcggccgctgctgtccggggagtcggagtcgacgtcgaagctgtcccgc
gagcacgccgtcgcgacaccggtgccgggcctcgtcgtcgtcgccggtgggaagtacacg
acctaccgggtcatggcgaaggacgcggtggacgccgccgtgcacggcctggacgcgaag
gtccccgcctcgtgcaccgcggaggtcccgctgctcggtgccgagggctaccacgcactg
accaacgcgaccgcgaacctggcccgttcgtcggggctgcacccggcgcggatcgagcac
ctgctcggccgctacgggtcgctgatccaggaggtgctcgacctcgccgccgccgacccg
acgctcaccgagccgctcgcgggcgcgccggactacctgcgcgccgaggtcgtctacgcg
gcgtcgcacgagagcgcccggcacctggaggacatcctggcccggcggacccggatctcg
atcgagaccttcgaccgcggggtcgaggcgacccaggaggcggcccggctcgtcgcgccc
gtactgggctggaacgacgagcaggtcgagcgcgaggtcgaccactaccgcaagcgggtg
gaggccgagcgggagagccagcggatgcccgacgacgcgaccgccgacgccgcccggctc
ggcgcgccggacgtcgtaccggtcagcggctga

DBGET integrated database retrieval system