KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102101281Help
Entry
102101281         CDS       T02921                                 

Gene name
TGM6
Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase 6
  KO
K05624  
transglutaminase 6 [EC:2.3.2.13]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Brite
Enzymes [BR:phi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     102101281 (TGM6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 700 aa AA seqDB search
MEALKIGKVNWQPKLNKAAHHTSDYSSTEVILRRGQPFNISLNLKTTAQSWDNFTFIAST
GPSPAESQQTKAIFSLSEEGASGWSATQEPSEPRCLNFTILSPADAVIGRYKLQLQLLAG
NKISSKVLGQFVLLFNPWCPDDDVYMADEKERQEYVLNDSGIIFQGVEKDIQEEAWNYGQ
FEEDILDISLAILDRSLNHREEPAVDVSQRSSPVYVSRVISAMVNSNDEKGVVEGKWSGK
FRSGTNPLRWSGSVTILRKWYRARYRPVRYGQCWVFAGVTCTVLRCLGIPTRVITNFNSA
HDKNLNLSIDKYIDVSGNNLHLSEDSVWNFHVWNESWFIRRDLGSFYDGWQVLDATPQEK
SKGIYQCGPASTRAIKEGDVNLDYDSPFVFAAVNADCVTWIRYSKKRKERIYSDTRKIGK
FISTKAVGTNSRVDVTANYKYPEGSSKERQVYKKALNLLGVRRPGKRTKVPRPRRRFSRA
QPAETPGISGKLLLDASPVIGQDILLTLTLRNSTSDFKTIKVKLKASAILYTRKPKAEIL
QLHRSVKLGSEEVKEISFKISYSQYKNSLMDDRKILVTAVCQLKQGASLLVEKDIVLQDP
FLTIKVLGAAVVHKPVSVEVTFTNPLSEEVTDCVLRAEGSGLLKEQLRIHVERMAPMETS
TVEFEIIPYRSGTRQLQVDLVCTHFSDIKGFVMLHVAPAQ
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atggaagccctaaaaataggaaaagtcaactggcaacccaaactaaataaagctgcacac
cacacctctgattacagcagcacagaagtaatcttgaggagagggcagcccttcaacatc
tctctgaacctcaaaacaacagcacaatcttgggacaacttcacctttattgcaagcaca
ggaccatctccagcagaatcccagcagaccaaggccatattttccctttctgaggagggt
gccagtggctggagtgcaacccaagagcccagtgagcctcgctgcctgaacttcaccatc
ctcagcccagccgatgctgtcatcggacgatacaaactccagctccagctccttgctggg
aacaagatctcctccaaagtcctgggccagtttgtgctgcttttcaacccctggtgtcca
gatgatgatgtctacatggctgatgaaaaggagcggcaggagtatgttctgaatgacagt
ggaatcatatttcagggagtggagaaagatattcaagaagaagcttggaactatggacag
tttgaagaggacatccttgatatctccctggctattctggatcggagcctgaaccaccgc
gaggagccagctgtggatgtctcccagcggagcagccctgtctatgtgagcagggttatc
agtgccatggttaacagcaacgatgagaaaggagtagtggaggggaagtggagcgggaag
ttccgctcgggaacaaaccccctgcgctggagcgggagcgtgaccatccttcggaagtgg
taccgggccaggtaccgacccgtgcgctacggccagtgctgggtctttgcaggagtcacc
tgcacagtattgagatgcttgggaatacctactcgtgttattacgaacttcaactctgcc
cacgacaagaacctaaatctgagcattgataagtacattgacgtgtctggaaacaacttg
catttgagtgaagacagtgtgtggaatttccatgtctggaatgaaagctggtttattaga
agagacctcggctctttttatgatggatggcaggttctggatgcaaccccccaggaaaaa
agcaaaggcatctatcagtgtggtcctgcctccaccagagccattaaagaaggggatgtg
aacctggattatgacagcccatttgtgtttgcagcagtgaatgctgactgtgttacttgg
attcgctatagcaagaaaagaaaagagagaatttattctgataccaggaagattgggaaa
tttatcagcaccaaagcagtgggcaccaactcccgtgtggatgtcactgccaattacaaa
tacccagaaggatcctcaaaagaaaggcaggtgtacaagaaggcactgaacctgcttggt
gtgagaagacctggaaaaagaaccaaagttccaagacccagaagacgattttcaagggca
cagcctgcagaaacccccggcatctcggggaagctgctccttgatgcatctcctgtgatt
ggccaggacatcctccttaccctgacactcagaaactcgacctcagattttaagaccata
aaggttaaactgaaggcttcagccattctctacaccagaaaacccaaggcagagattttg
cagttgcataggtctgttaaacttggatctgaggaagtgaaagagatttctttcaagatc
tcctattcccagtacaaaaactctctgatggatgacaggaagatcctagtgactgctgtg
tgtcaactcaaacagggagcctcacttctagttgagaaggatattgtactccaggatcct
tttctcaccatcaaggtcctgggtgcagctgtggtgcacaagcctgtcagcgtggaggtg
acatttaccaaccctctgtctgaggaggtgacagactgtgtcctgagagctgaaggcagt
ggcctgctcaaagagcagctccgaatccatgtggaaagaatggcccccatggagacttca
acagtggaatttgaaatcattccctacaggagtggcaccaggcagcttcaggtggacttg
gtttgcacccacttttcagacattaagggatttgtgatgctccatgtggctcctgctcag
tga

DBGET integrated database retrieval system