KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102111993Help
Entry
102111993         CDS       T02921                                 

Definition
(RefSeq) pancreatic alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102111993
Enzymes [BR:phi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     102111993
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 513 aa AA seqDB search
MQVILLLLAAAGLCWGQYNPNTLPKRTSIVHLFEWRWQDIAQECERYLAPNGFGGVQVSP
PNENLVITNPDRPWWERYQPISYKLCTRSGNEEEFRDMVTRCNNVGVRIYVDAVVNHMCG
AAGGSGTHSTCGSYFNAGNRDFPAVPYSGWDFNDGKCHSASGEIENYGDIYQVRDCRLSS
LLDLALEKDYVRSKIAEYLNHLIDIGVAGFRLDAAKHMWPGDIKAFLDKLNNLNTQWFSE
GTKPFIYQEVIDLGGEPIKGSEYFGNGRVTEFKYGAKLGTVIRKWNGEKMAYLKNWGEGW
GFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMASGFMLAHPYGFTRVMSSFRW
PRYFENGKDINDWVGPPSNADGSTKPVTINEDTTCGNDWVCEHRWRQIRNMVIFRNVVDG
EPFSNWWDNGSNQVAFGRGNKGFIIFNNDDWNMNVYLQTGLPAGTYCDVISGQKEDNKCT
GKQVFVSGDGMANFQINTDAEDPFIAIHVDAKL
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtcatcctcctcctcctcgcagctgcagggctctgctgggggcagtacaacccc
aacactctcccaaagagaacatctattgtgcatctctttgaatggcgctggcaggatatt
gctcaggagtgtgaacgctacttagctcctaatggatttggaggtgttcaggtttcgcct
ccaaatgaaaaccttgttattactaacccagacagaccctggtgggaaagatatcagccc
attagctacaagctctgcactcgatcaggaaatgaagaggaattcagagacatggtgacc
agatgcaacaacgttggagttcgtatctatgtggatgctgtcgtcaaccatatgtgtggg
gctgcaggtggttcaggcacacattctacctgtggaagctattttaatgctggaaacaga
gattttccagctgtaccatactctggctgggatttcaatgatggcaaatgtcactctgca
agtggagaaattgaaaattatggtgatatatatcaggtccgggactgccgcttgtccagc
ctcctggatctggccttggagaaggactatgtgcgctcaaagattgcagagtacctgaac
catctcattgacattggggtagcaggattccgacttgatgctgccaagcacatgtggcct
ggggacataaaagcatttctggacaagctgaataatctaaatactcaatggttttctgaa
ggaactaaacctttcatataccaggaggtaattgacttgggtggagagcccatcaaaggc
agcgaatactttggaaatggccgagtgacagaattcaaatacggtgccaagctggggaca
gtgatccgcaagtggaacggagaaaagatggcctacttaaagaactggggagaaggctgg
ggctttgtgccttccgacagagccctggtctttgtggataaccacgacaaccagagagga
cacggggctggtggagcttctattctcaccttctgggatgccaggctctataaaatggca
tctggtttcatgcttgcccacccgtacgggttcacacgtgtgatgtcaagtttccggtgg
ccaagatattttgaaaatggaaaggatatcaatgactgggttgggcccccaagtaacgcg
gatggctccacaaagcctgttacaatcaacgaggacacgacctgcggcaacgactgggtt
tgtgaacatcgctggcgtcagatcaggaacatggttatcttccgtaacgtggtggatggt
gagcctttctccaactggtgggacaatggcagcaatcaagtggcttttggccgtggtaat
aaaggcttcatcatcttcaataatgatgactggaatatgaacgtctatctgcaaactgga
ctgcctgctggtacctattgtgatgttatttctggacaaaaggaagacaacaaatgtact
ggaaagcaagtgtttgtttctggtgatggaatggctaatttccagattaataccgatgct
gaagatccatttattgcaatccatgttgatgcaaaattataa

DBGET integrated database retrieval system