KEGG   Phycisphaera mikurensis: PSMK_24910Help
Entry
PSMK_24910        CDS       T01800                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
phm  Phycisphaera mikurensis
Pathway
phm00730  Thiamine metabolism
phm00790  Folate biosynthesis
phm01100  Metabolic pathways
phm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:phm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    PSMK_24910
   00790 Folate biosynthesis
    PSMK_24910
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PSMK_24910
Enzymes [BR:phm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     PSMK_24910
Exosome [BR:phm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PSMK_24910
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:phm00537]
 Enzymes
  PSMK_24910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-ProteinID: BAM04650
UniProt: I0IHB2
LinkDB All DBs
Position
complement(2967568..2969268)
Genome map
AA seq 566 aa AA seqDB search
MIRTSTLLRVFLVGVGVAGGSAAAAQEAKNLFVLISDGAGFNQFNAASMYQHGDLGRLPY
EQAGWTKVGASTHPLTFNREPDGAGQDPTLVYDPAAAWDTSAQPVDNARVPFADPLSPTA
PGAASNSGGPFAGYNFLKSTYTDSAAAGTAIAAGVRTFNSGINWTNDDAPLTGQTIAELA
RANNRATGVVSSVYFSHATPATMGGAHNVSRGNTQEIANQMLDEGTLDLIFTPGHPEYDD
AGNFTPLDVNDPTSTAARNIGGTATYVELKAGTHAGGWDLVEDRADFEALAADPAAATQG
RLLGLAQSRNSLQYLRPITDDWDGNGVVDNEPFTPFFPLTEAQKAERQAAPVNPGDDSAG
DPFNAATPTLATLTKAAIHQLDAQQDREGMYLMVEGAQVDWAGHGHNTTRLIEEQVDFND
SVDAVLDWVAANDPNFDETLVMVLADHEAGMLWGPDGDTEAFDLIETAGIGNKPEMLMQS
TQHTNQLVPIYARGVGAALLNGFTEGVDTEYLARYGMAGLEGWGDGYVGLTASFEVMSAV
VPEPSSAVLAAAGGLLVLPRRRRRGS
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgattcggacctcgactctgcttcgtgtgttcctggtgggcgtgggcgtggccggcggg
agcgccgccgcggcgcaggaggcgaagaacctgttcgtgctgatcagcgacggcgcgggc
ttcaaccagttcaacgcggcctcgatgtaccagcacggcgacctgggccggctgccctac
gagcaggccggctggaccaaggtgggtgcctcgacgcacccgctcaccttcaaccgtgag
cccgacggcgccgggcaggaccccacgctggtctacgacccggccgccgcgtgggacacg
agcgcccagccggtggacaacgcgcgggtgccctttgccgacccgctcagcccgaccgcc
cccggagcggccagcaactccggcggccccttcgcgggctacaacttcctcaagagcacg
tacaccgactcggccgcggcgggcacggccatcgccgcgggcgtgcggaccttcaacagc
ggcatcaactggaccaacgacgacgcgccgctcaccgggcagacgatcgcggagctggcc
cgcgccaacaaccgcgccaccggcgtggtgagcagcgtctacttcagccacgccacgccg
gccacgatgggcggggcccacaacgtgagccgcggcaacacgcaggagatcgccaaccag
atgctcgacgagggcacgctggacctgatcttcacgcccggccacccggagtacgacgac
gccggcaacttcacgccgctggacgtgaacgacccgaccagcaccgccgcccgcaacatc
ggcggcaccgccacctatgtggagctcaaggccggcacccacgccggcggctgggacctc
gtggaggaccgggccgacttcgaggccctcgccgccgaccccgccgccgcgacgcagggc
cggctgctgggcctggcgcagtcgcggaactcgctgcagtacctccgcccgatcacggac
gactgggacggcaacggcgtcgtcgacaacgagcccttcacgccgttcttcccgctcacc
gaagcgcagaaggccgagcggcaggccgcgccggtgaaccccggcgacgactccgcgggc
gaccccttcaacgcggcgacgccgacgctggcgacgctgaccaaagcggcgatccaccag
ctcgatgcccagcaggaccgggaagggatgtacctgatggtcgagggcgcgcaggtggac
tgggcgggccacgggcacaacacgacgcggctgatcgaggagcaggtcgacttcaacgac
tccgtggacgccgtgctggattgggtggccgccaacgatcccaacttcgacgagacgctg
gtgatggtgctcgccgaccacgaggcgggcatgctctggggccccgacggcgacaccgag
gccttcgacctcatcgagaccgccggcatcggcaacaagcccgagatgctcatgcagtcc
acccagcacaccaaccagctggtgccgatctacgcgcgcggcgtgggtgcggccctgctc
aacgggttcaccgagggcgtcgacaccgagtacctcgcccgctacggcatggccgggctc
gagggctggggcgacgggtacgtcggcctcaccgccagcttcgaggtgatgtccgccgtc
gtccccgagccctccagcgccgttctcgcggccgccggcgggctgctcgtgctgccgcgc
cgccggcggcgcggcagctga

DBGET integrated database retrieval system