KEGG   Pyrococcus horikoshii: PH1622Help
Entry
PH1622            CDS       T00014                                 

Gene name
PH1622
Definition
(GenBank) 559aa long hypothetical DNA ligase
  KO
K10747  
DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
pho  Pyrococcus horikoshii
Pathway
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Brite
KEGG Orthology (KO) [BR:pho00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    PH1622 (PH1622)
   03410 Base excision repair
    PH1622 (PH1622)
   03420 Nucleotide excision repair
    PH1622 (PH1622)
   03430 Mismatch repair
    PH1622 (PH1622)
Enzymes [BR:pho01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     PH1622 (PH1622)
    6.5.1.6  DNA ligase (ATP or NAD+)
     PH1622 (PH1622)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     PH1622 (PH1622)
DNA replication proteins [BR:pho03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    PH1622 (PH1622)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     PH1622 (PH1622)
DNA repair and recombination proteins [BR:pho03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     PH1622 (PH1622)
   NER (nucleotide excision repair)
    Other NER factors
     PH1622 (PH1622)
   MMR (mismatch exicision repair)
    Other MMR factors
     PH1622 (PH1622)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1439153..1440832
Genome map
AA seq 559 aa AA seqDB search
MKYIELAQLYQKLEKTTMKLIKTRLVADFLKRVPEDHLDFIPYLILGDVFPEWDERELGV
GEKLLIKAVSMATGVDPKEIENSVKDTGDLGESIALAIKRRKQKSFFSQPLTIKRVYQTL
VKIAETTGEGSQEKKMKYLANLFMDAEPLEAKYLARTVLGTMRTGVAEGLLRDAIALAFH
VKVELVERAYMLTSDFGFVAKIAKAEGNEGLEKVTIQLGKPIKPMLAQQAANIKEALLEM
GGEAEFEIKYDGARVQVHKDGEKVIIYSRRLENVTRAIPEIVEAIKEAIEPEKVIVEGEL
VAIGEEGRPLPFQYVLRRFRRKHNIEEMMKKIPLELNLFDVLYVDGKSFVDTKFIERRKK
LEEIVKPNGKIKVAENLITKNAEEAEKFYKRALEMGHEGLMAKRLDAVYEPGNRGKKWLK
IKPTMENLDLVIIGAEWGEGRRAHLFGSFILGAYDPETGEFLEVGKVGSGFTDDDLVEFT
KMLKPLIVKEEGKRVVIQPKIVIEVTYQEIQKSPKYRSGFALRFPRYVALRDDKGPEDAD
TIERIAQLYELQERIKGKV
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgaagtatatcgagcttgcccaactttatcaaaaattggaaaaaacaacaatgaaactt
attaaaacaagactcgttgctgattttttgaagagggttccagaagatcatttagacttc
attccatacttaatactgggagatgtattcccagagtgggatgaaagggagcttggagtt
ggggagaagctgttgataaaagcagtctcaatggcaacaggtgttgacccgaaggagata
gagaactcggtcaaagatactggagatcttggggaaagtattgccctcgccattaagaga
agaaagcagaaatcattcttctcccaaccattaacaattaagagggtctaccaaactcta
gttaaaatagctgagactactggagagggaagtcaagagaaaaaaatgaagtatttagcc
aacctatttatggatgctgagcctttagaggcgaaatacctcgccagaacagttctagga
accatgagaacgggagtggcagaaggattgctaagagatgcaatagctttggcattccac
gtgaaggtagagctagttgaaagggcttacatgctcacgagcgattttgggtttgtggca
aaaatagcaaaagccgaaggaaatgaaggacttgagaaggtaacaatccagttagggaag
cctataaagccaatgctagctcaacaagccgctaacattaaggaggcccttttagaaatg
gggggagaggccgagttcgaaattaagtacgatggagcaagagttcaagttcacaaagat
ggagagaaggtgataatatactcaaggagactggaaaatgtaaccagggcaattccagaa
attgttgaagccataaaggaagctattgagccagaaaaagttatagttgaaggggaactt
gtagcaataggagaagagggaagacctttaccattccagtatgttcttcgcaggttcaga
aggaagcacaatatagaggagatgatgaagaagataccattggagctaaatctcttcgat
gttctctatgtcgacggtaagagctttgtagatacaaagtttatagagagaaggaagaaa
cttgaagagatcgttaagccaaacggaaagataaaagtagcagagaacctcataactaag
aacgctgaagaagctgagaaattctataagagagcactagagatgggacatgaaggcctt
atggcaaagagacttgatgcagtatatgaacctggaaacagaggaaagaaatggctcaaa
atcaagccaaccatggaaaaccttgacctcgtgataattggagctgaatggggggagggg
agaagagcacacctatttgggtcgtttatcctgggagcttacgatcctgagaccggggaa
ttccttgaggtcggaaaagtcggaagtggattcacagacgacgacttagttgagtttaca
aagatgttaaagcccttaatagttaaggaagaaggaaagagagtggttatacaaccaaag
atcgttatagaagtaacgtaccaggaaatccaaaagagtcctaagtacaggagcggattt
gccttaagatttccaaggtatgttgcactaagagatgacaagggacctgaggatgcagac
acgatagaaaggatagcccaactctatgaactgcaggaaaggattaagggaaaagtttaa

DBGET integrated database retrieval system