KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM034490Help
Entry
Phum_PHUM034490   CDS       T01223                                 

Definition
(RefSeq) Angiotensin-converting enzyme, putative
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
phu  Pediculus humanus corporis (human body louse)
Brite
Enzymes [BR:phu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     Phum_PHUM034490
Peptidases [BR:phu01002]
 Metallo Peptidases
  Family M2
   Phum_PHUM034490
Exosome [BR:phu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Phum_PHUM034490
CD molecules [BR:phu04090]
 Proteins
  Phum_PHUM034490
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
VectorBase: 
UniProt: 
LinkDB All DBs
AA seq 627 aa AA seqDB search
MFLLFLFLFAKFAFSQDTTNIEGNNESLEEALQFLREYDVEGSAICTRVTLAQWNFSTNV
STINRKKMVCYNKCGNDYGRTVMEQTLYDKFQKLSRRKATEFAWTKLPDPDVRRQMKKLI
TQGRFSLHDDQFNELKDVISQMKEIYTKGTICPYNKNPVYCDQKLEPTLTKIMAKSRDYH
ELLHVWKSWRDAVGPPIRQKYIRYVELANQAARLDGFNDAGDQMKSVYEIPNFEDHLSEL
WNMIEPFYKQLHAYVRRKLIKFYGSKYIRHDGPIPAHLLGNMWAQSWKNIEELIIPYPGK
TIGDITPELIRQVAEEFFISLGLKPMPPEFWRHSLLEKPIGREVVCRASAWDFCNKMDYR
IKQCTEVTMEDFLTIHHEMAHIEYYLQYADQPYLYREGANPAFHEAVGDVIVLSVQTPRH
LQRIGLLNNITDDYETNINYLLSMALEKVVYLPFAYIVDKWRWNVFAEGINNMNSKWWEL
KLNYQGLIPPVPRSESDFDAAAKYHVASDTPYIRYFLSVIIQFQLYESLCEASGHYGPLH
TCDIYRSREAGRLLREILQSGSSRSWSDVINVMTKGKIKKISASSLLNYFKPLLTWLEVQ
NKEELYVGWTTGPHDTGKIMDDVITRR
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atgtttttgttgtttttgtttttgtttgcaaaatttgccttctcacaagataccaccaac
attgagggtaacaacgaaagtttagaagaagctttacaatttcttcgagaatatgatgtt
gaaggaagcgccatatgtacaagagtaacattggcacaatggaatttcagtacaaacgta
tcgacaataaatagaaaaaaaatggtttgttataataaatgtggcaatgattatggcaga
acggtgatggaacaaacattatacgacaaatttcaaaaattatcacggaggaaagcaaca
gaatttgcatggacgaaacttcccgatccggatgtcaggcgacaaatgaaaaaattaata
acacaaggaagattttcattacacgacgatcaatttaacgaactcaaggacgttataagt
caaatgaaagaaatttacacgaaaggtacaatatgtccgtacaataaaaatccagtttat
tgcgatcaaaaattggaaccgacattaacgaaaataatggcaaaatcaagagactatcac
gaattgttacacgtttggaaatcgtggagggatgctgttggacccccgataagacaaaaa
tacataagatatgtagaattggcaaatcaagctgccagattagatggttttaacgatgct
ggagatcaaatgaaatccgtttatgaaattccaaatttcgaagatcatttatctgaatta
tggaacatgatcgaacctttttacaaacaactacacgcatacgtcaggagaaaacttatt
aaattttacggatcgaaatatatacgtcacgatggtccgataccagctcatcttttgggt
aacatgtgggcacaatcttggaaaaatatcgaagaattaattattccttatcccggaaaa
acaatcggtgatatcacacccgaattgataagacaagttgccgaagaattttttatatcc
cttggattaaagccaatgcctccagaattttggagacattcacttttagaaaaaccaatc
ggtagagaagttgtttgcagagcttcggcgtgggatttttgtaataaaatggattataga
ataaaacaatgcacagaagtcacgatggaagattttctaacgattcatcacgaaatggca
cacatcgaatattatttacaatatgcagatcaaccttatttatatagagaaggagcgaat
ccagcatttcacgaagctgttggtgatgtcatagtactttccgttcaaacacccagacac
cttcaaagaatcggtcttttaaataacataaccgacgattacgaaacgaatataaattat
ttattatccatggcattggaaaaagtggtttatttaccgtttgcatatatagtagacaaa
tggcggtggaacgtttttgcagaagggattaataacatgaattcaaaatggtgggaattg
aaattaaattatcaaggattgataccacccgtgcctagaagcgaatctgatttcgatgct
gctgctaaatatcacgtagcttccgacactccttacataaggtattttttaagcgtcata
atacaattccagttgtacgaatctttatgcgaagcttcggggcattatggaccacttcat
acctgtgacatttacagatcgagagaagccggacgtttgctacgagaaatattacaatct
ggatcttctcgttcttggtctgacgtcatcaacgttatgacgaaaggaaaaataaaaaaa
atttcagcaagttctttattgaattattttaaacctttgttaacctggttggaagtacaa
aataaagaagaattatacgttggttggactaccggtcctcacgataccggtaagattatg
gatgacgtcatcacaagacggtga

DBGET integrated database retrieval system