KEGG   Pseudoalteromonas issachenkonii: PI2015_0774Help
Entry
PI2015_0774       CDS       T04164                                 

Definition
(GenBank) Cysteine sulfinic acid decarboxylase
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
pia  Pseudoalteromonas issachenkonii
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Quorum sensing
Brite
KEGG Orthology (KO) [BR:pia00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    PI2015_0774
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PI2015_0774
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PI2015_0774
   00430 Taurine and hypotaurine metabolism
    PI2015_0774
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    PI2015_0774
Enzymes [BR:pia01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     PI2015_0774
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
I:858380..860005
Genome map
AA seq 541 aa AA seqDB search
MDQKRCAVASKESLKRIFTVPEAPDSTLSKIELEISSNLAGFLNENIAAIEKPLHEIEKD
FQSAAIPEEPTFVSCYAQDIMEQLVAHSVHTAAPSFIGHMTSALPHFLLPLSKLMVGLNQ
NLVKIETSKAFTPLERQVLGMMHHLAYGQSDGFYSKWMHSAKTSLGAFCSGGTVANITAL
WIARNRLLKADGNFKGIAAQGLVAGMLHYGYKGLAVLISERGHYSLGKSVDLLGIGRENL
IGIKTSADNKVDVSAMREKALELEAQGIKVMAIIGVAGTTETGNIDPLEDMANLAQEINC
HFHVDAAWGGATLLSNTHRHLLKGIEHADSITIDAHKQMYVPMGAGLVLFKDPAATDAIE
HHAEYILRKGSKDLGSHTLEGSRPGMAMLVHACLRVIGRKGYEMLIDRSIKKARYFADLI
KADEDFELISEPELCLLTYRYVPKQIKHAIAQADAQTRLDIFAALNRFTASMQKRQRESG
RSFVSRTRLTPVQYDNQPTVVFRVVLANPLTSGAILKEILEEQKELAQTDPVFKKYLRKY
M
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggatcaaaagcgttgtgccgtcgcctctaaagaaagccttaaacggatattcaccgtt
ccagaggcgccagactcaactttgagcaaaatagagcttgaaatttcgagtaatttagca
ggtttcttaaacgaaaatatcgcggcaattgaaaaaccattacatgaaatagaaaaagat
tttcaatcggcggcaatccctgaagaaccgacgtttgtgtcttgctatgctcaagatatt
atggagcagctggttgctcattctgttcataccgcagcgccaagctttattggccatatg
acatcggctctgcctcattttttactaccgttatcgaaattaatggttgggttaaatcaa
aacctagtaaaaattgaaacctcgaaagcgtttaccccattagaacgtcaagttttaggg
atgatgcatcatttagcttatggccaaagtgatggtttttattctaaatggatgcacagt
gcaaaaacctcgttaggtgcattttgctctggcggcaccgtggcaaatattactgcactt
tggatagctcgaaaccgtttattaaaagcggatggcaattttaaaggtattgctgcacaa
ggtttagttgcaggaatgcttcactatggttacaaagggctggcagttttaatttctgaa
cgaggtcattattcgcttggtaaatcggttgatttattaggtattggtcgtgaaaattta
attggtattaaaacttctgccgataataaagtcgatgttagtgcaatgcgagaaaaagcg
ttagagcttgaagcacaaggcattaaagtgatggcaattattggagtcgcaggaaccact
gaaaccggtaatattgacccacttgaagatatggctaatttagcacaagagattaattgt
cattttcatgttgatgcagcgtggggtggagctactttactgtctaatacccataggcat
ttattaaaaggtattgagcatgcagattcaatcaccattgatgcgcataagcaaatgtat
gtgccgatgggggccggtttagtcttatttaaagaccctgctgcaactgatgccatcgag
catcatgctgaatatattttacgtaaaggctctaaagatttaggcagccatacgcttgag
ggaagtcgccctgggatggcgatgttagtgcatgcttgtttacgtgttattggtcgtaaa
ggctatgaaatgcttatcgatcgcagtattaaaaaagcgcgttattttgctgatttaata
aaagccgatgaagattttgagttaatatcagagccagaactttgcttactgacctatcgc
tatgtaccaaaacaaattaaacatgcgatagcccaagctgatgcacaaacccgtttagac
atttttgccgcgcttaatcgttttactgccagcatgcaaaaacgccaacgtgaatcgggt
cgctcatttgtatcgcgtacgcgtttaacgccagttcaatatgataaccaaccaaccgtg
gtatttagagtggtacttgcgaacccgcttacctcaggtgctatattaaaagagatatta
gaagagcagaaagaactggcacaaactgatccggtgtttaaaaagtatttacgaaaatat
atgtaa

DBGET integrated database retrieval system