KEGG   Pseudomonas knackmussii: PKB_3383Help
Entry
PKB_3383          CDS       T03081                                 

Gene name
icd3
Definition
(GenBank) Isocitrate dehydrogenase [NADP]
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
pkc  Pseudomonas knackmussii
Pathway
pkc00020  Citrate cycle (TCA cycle)
pkc00480  Glutathione metabolism
pkc01100  Metabolic pathways
pkc01110  Biosynthesis of secondary metabolites
pkc01120  Microbial metabolism in diverse environments
pkc01130  Biosynthesis of antibiotics
pkc01200  Carbon metabolism
pkc01210  2-Oxocarboxylic acid metabolism
pkc01230  Biosynthesis of amino acids
Module
pkc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pkc_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:pkc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PKB_3383 (icd3)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PKB_3383 (icd3)
Enzymes [BR:pkc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     PKB_3383 (icd3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH DUF4115
Motif
Other DBs
NCBI-ProteinID: CDF84726
UniProt: A0A024HIM1
LinkDB All DBs
Position
3560646..3562868
Genome map
AA seq 740 aa AA seqDB search
MSNRSKITYTFTDEAPALATYSLLPIVKAFAASADIDVETRDISLAGRILASFTDKLGDK
AIEDDLAYLARLATAPDANIIKLPNISASVPQLKGAIAELQALGYAVPDFPEDPQTDEEK
DTRARYAKVLGSAVNPVLREGNSDRRAPAAVKAYARKHPHSMGKWSMASRSHADYMRGGD
FFSSEQSVTIPKAGEVRIEFIGKDGKVEVKKKLAMQEGEVLDSMFMSCQKLRAFFEKTLQ
DCKETGVMWSLHVKATMMKISHPIVFGHAVTVYYKDVFEKYGQLFDELGVNPNNGISSVY
EKIKSLPASQQEEILHDIHEVYSHRPEMAMVDSVKGITNLHIPSDVIVDASMPAMIRNSG
QMWGKDGKQKDTKAVMPESTYARIYQEMINFCKTNGAFDPTTMGSVPNVGLMAQKAEEYG
SHDKTFEMEADGTMRVVDADGKVLMQHEVEAGDIWRACQTKDAPIRDWVKLAVTRARQSN
TPAIFWLDPERAHDNELRKKVELYLKDHDLTGLDISIKGYNEAIRTSMERMIRGQDTISV
TGNVLRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVQQLVEENCLRW
DSLGEFLALAVSFEEEGIKTGNAKAKILGKTLDEATGKLLDNNKSPARKVGEIDNRGSHF
YLAMYWAQALAAQNEDAELKAHFAPLAKTLTEQEAAIVAELNGAQGKPVDIGGYYRSNPE
KTSQVMRPSAIFNAAIDSLN
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaccgctcgaagatcacctacaccttcaccgacgaagcacccgccctcgccacc
tactcgctgctccccatcgtcaaggccttcgctgcctctgccgacattgacgtcgaaacc
cgagacatctctcttgcaggacgcatcctcgcctcgttcaccgacaagctcggcgacaag
gccatcgaggacgatctggcctacctggcccgcctggccaccgcgccggacgcgaacatc
atcaaactcccgaacatcagcgcctcggtcccgcaactgaaaggcgccatcgccgagctg
caagccctgggctacgccgtgccggacttcccggaagatccgcagaccgatgaagagaaa
gacacccgcgcccgctacgccaaagtcctgggcagcgccgtgaacccggttctgcgtgaa
ggcaactccgaccgccgtgcaccggcagcagtcaaggcctatgcccgtaagcacccgcac
agcatgggcaagtggagcatggcttcccgctcgcacgcagactacatgcgcggcggcgac
ttcttctccagcgaacagtcggtcaccattccgaaggcaggtgaagtccgcatcgagttc
atcggcaaagacggcaaggtcgaggtcaagaagaagctcgcgatgcaggaaggcgaagtc
ctcgacagcatgttcatgagctgccagaaactgcgcgccttcttcgagaagactctgcaa
gactgcaaagaaaccggcgtcatgtggtccctgcacgtcaaggcgaccatgatgaagatc
tcccacccgatcgtcttcggccacgccgtgaccgtctactacaaggacgtcttcgagaag
tacggccagttgttcgacgagttgggcgtcaacccgaacaacggcatctccagcgtctac
gagaagatcaaatccctgccggcctcccagcaggaagagatcctccacgacatccacgag
gtgtacagccaccgccctgaaatggcgatggtcgactcggtcaagggcatcaccaacctg
cacatccccagcgacgtgatcgtcgacgcctccatgccggccatgatccgcaactccggc
cagatgtggggcaaggacggcaagcagaaagacaccaaggcagtgatgccggaaagcacc
tatgcccgcatctaccaggagatgatcaacttctgcaagaccaacggcgccttcgacccg
accaccatgggcagcgtaccgaacgtaggcctgatggcgcagaaggccgaggaatacggc
tcgcacgacaagaccttcgagatggaagccgacggcaccatgcgcgtggtcgatgccgac
ggcaaggtgctgatgcagcatgaagtcgaagccggtgacatctggcgcgcctgccagacc
aaggacgccccgatccgtgactgggtcaagctggccgttacccgtgcccgccagtccaac
accccggccatcttctggctggacccggagcgcgcccacgacaacgaactgcgcaagaag
gtcgagctgtacctgaaagaccacgacctgactggcctggacatcagcatcaaaggctac
aacgaagccatccgcaccagcatggagcgcatgattcgcggccaggacaccatctcggtg
actggcaacgtgctgcgcgactacctgaccgacctgttcccgatcatggaactgggcacc
tcggcgaagatgctgtccatcgttccgctgatggcgggcggcggaatgtacgagaccggc
gccggcggttcggctccgaagcacgtacagcaactggtcgaagagaactgcctgcgctgg
gattccctgggtgaattcctggcccttgccgtgtccttcgaagaggaaggcatcaagact
ggcaacgccaaggccaagatcctgggcaagaccctcgacgaagctaccggcaagctgctg
gacaacaacaagtccccggcgcgcaaggtcggcgaaatcgacaaccgcggcagccacttc
tacctggcgatgtactgggcccaggccctggctgcgcagaacgaagatgccgaactgaaa
gcgcacttcgctccgctggccaagaccttgaccgaacaggaagcggccatcgtcgctgaa
ctgaacggtgcccagggcaagcccgtggacatcggtggctactaccgctccaacccggag
aaaaccagccaggtgatgcgtccgagcgccatcttcaacgccgccatcgacagcctgaac
tga

DBGET integrated database retrieval system