KEGG   Pantoea ananatis LMG 5342: PANA5342_0777Help
Entry
PANA5342_0777     CDS       T01728                                 

Gene name
pepM
Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
plf00440  Phosphonate and phosphinate metabolism
plf01100  Metabolic pathways
plf01120  Microbial metabolism in diverse environments
plf01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:plf00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    PANA5342_0777 (pepM)
Enzymes [BR:plf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     PANA5342_0777 (pepM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase ICL
Motif
Other DBs
NCBI-ProteinID: CCF08170
LinkDB All DBs
Position
801910..802764
Genome map
AA seq 284 aa AA seqDB search
MIKKLIAEKGTLIFIEAHNPLSALIASKAEQTNSEGRIVKFDGIWSSSLTDSASRGIPDN
ETLALSSRLENIADIRNVTDMPIIMDADTGGKPEHFSYYVKRMINNGVNGVIIEDKTGLK
KNSLFGTEVEQTLADINDFSEKIKRGKSAVYIDDFMIIARLESLIAGFDVEHALERADAY
VEAGADGIMIHSCKKTPDEVFLFSTKFRKKYPSVPLICVPTTYSATSNRELSEAGFNVII
YANHMLRAAYKAMENVSKEILRYGRTAEIEKSCMSVKEIISLIP
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaaaacttattgcagaaaagggtactctgatttttattgaggcccataatccg
ctctccgcattaattgcgtctaaagcagaacaaactaattcagaaggccgtattgtcaaa
tttgacggtatatggtcaagctcgttaacggactcagcatctcgcggtattcccgataac
gaaacactggcattaagcagcaggttagaaaatattgctgatatccgaaatgtgacagac
atgcccatcatcatggatgctgatacggggggaaaaccagaacattttagttattacgta
aaaagaatgattaacaacggtgtaaatggcgtcatcatcgaagataaaacaggattaaag
aaaaattctttgttcggcactgaagtagaacagactctcgcagatattaatgatttttca
gagaagattaaaagaggaaaatctgcagtttatattgatgattttatgatcatagccaga
cttgaaagtcttattgcagggttcgacgtagaacatgcactcgaacgtgccgacgcatac
gtcgaagccggggcagacggaattatgattcatagttgtaagaagactccggatgaggtt
ttcttattcagtacgaaatttcggaaaaaatatccatcagtaccattaatttgtgttcct
actacttattctgcaaccagcaacagagaactcagtgaagcgggttttaacgtgatcatt
tatgcaaaccatatgctcagggctgcttataaagcaatggaaaatgtttcaaaagaaata
ttgagatatggcaggacggcagagatagaaaaatcttgcatgagtgtaaaggaaattatt
tcactgattccttaa

DBGET integrated database retrieval system