KEGG   Pantoea ananatis LMG 5342: PANA5342_2424Help
Entry
PANA5342_2424     CDS       T01728                                 

Gene name
gst1
Definition
(GenBank) glutathione S-transferase domain-containing protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
plf00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:plf00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PANA5342_2424 (gst1)
Enzymes [BR:plf01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     PANA5342_2424 (gst1)
Transporters [BR:plf02000]
 Other Transporters
  Pores ion channels [TC:1]
   PANA5342_2424 (gst1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_N_2 GST_N_3 GST_C_2 GST_C_3 Tom37 GST_C_6
Motif
Other DBs
NCBI-ProteinID: CCF09817
LinkDB All DBs
Position
2539209..2539814
Genome map
AA seq 201 aa AA seqDB search
MKLFCKAGACSLSPHIVMRECGLDFTQVNVDLQTKLTERGEDFRQINPKGQVPALQLSDG
NVLTEGAAIVQYLADLKPDRHLLAPVGSLTRYHTIEWLGYISSELHKSFSPLFRNDAPEE
YKALVRRQLEAKFAWVNDELKDKQWLMGVHFSVADAYLFVVTRWAKALNLDLAARDHLQH
WFERVAERPSVQAALKAEGLN
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttttgtaaagctggtgcctgttccctttcaccgcatatcgtcatgcgtgaa
tgtggtctggactttacgcaggttaatgttgatctgcagactaagctcaccgagcgcggt
gaagattttcgccagatcaaccccaaaggtcaggtgccggccctgcagctgagcgatggg
aatgtattaacggaaggcgcggcgattgtgcagtatctggccgatcttaaacccgatcgt
cacctcctggccccggtggggagcctgacgcgttatcacaccattgagtggctcggctat
atcagcagcgagttacacaaaagcttctctcccttgtttcgcaacgatgcgcctgaggag
tacaaagcgttggtgcgccgccagctggaggcgaaatttgcctgggtaaacgatgagctt
aaagacaaacagtggctgatgggcgtgcactttagcgtcgcggatgcctatttatttgtg
gttacccgctgggcaaaagcgctgaacctggatttggccgcgcgggaccacctgcaacac
tggtttgaacgcgttgcagagcggccgtcggttcaggccgcgctcaaagcggaaggactt
aactga

DBGET integrated database retrieval system