KEGG   Planctomyces sp. SH-PL62: VT85_20380Help
Entry
VT85_20380        CDS       T04401                                 

Gene name
glpD
Definition
(GenBank) Aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
plh  Planctomyces sp. SH-PL62
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:plh00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    VT85_20380 (glpD)
Enzymes [BR:plh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     VT85_20380 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
5201877..5203472
Genome map
AA seq 531 aa AA seqDB search
MSPNTLSRGENLDRVRAGGIWDVVIIGGGATGLGAAVDAASRGYRTLLLEAVDFAHGTSS
RSTKLVHGGVRYLAQGNVPLVREALRERGLLARNAPHVVHSRDFIVPAYRYWQLPFYGIG
LWLYDRLAGRLSLGRSRWLSRAEVLRRTPTIRESGLRGGILYTDGQFDDARLAISLARTA
ADLGASILNHFAVVGLVKEMGRIVGVRAKDEETGETFEIRARSVVNATGVYVDAVRRLDQ
PDASALLAPSQGAHIVLDRSFLPGDAAVMIPKTDDGRVLFAIPWHDRTLIGTTDVPLSAT
PREPRPLAEELEFLMEHAGRYLSKTPRREDVRSQFAGLRPLINAEAGRGGQTKKLSREHA
VVVSDSGLITITGGKWTTYRVMGRDVVDHAAEVGGLPRKPSKTESLHLHGWTEHPAAKEE
TLALYGSEAADIRAIVDASPEAGRKLHERLPYLEAEVVWGVRHEAARTIEDVLSRRTRAL
FLDARACIEAAPRVAAIMAEELGEDEAWRDREVSRFLALAATYLPASGEGS
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccgaatacgttgtcgcgcggagaaaatctggatcgcgtccgcgccggggggatc
tgggacgtcgtcatcatcggcgggggcgcgaccgggctgggggccgcggtcgatgcggcc
tcgcgaggctaccggacgctcttgctggaggcggtcgacttcgcccacggcacgtcgagc
cggagcacgaagctggtccacggcggggtccgctatctcgcccaggggaacgtcccgctg
gtccgcgaggcgctccgtgaacgcggcctcctcgcgcgcaacgccccgcacgtggtgcat
tcccgcgacttcatcgtgcccgcgtaccgctactggcaactgccgttttatgggatcggg
ctctggctgtacgaccggctggcgggccgcctcagcctgggccggtcgagatggctctca
cgcgcggaggtcctgcggcggacgccgacgatccgcgagtccggccttcgcggcggcatc
ctctacaccgacggccagttcgacgacgcccggctggcgatctcgctggccaggacggcg
gccgacctgggggcctcgatcctcaatcatttcgcggtggtcgggctcgtcaaggagatg
ggccggatcgtcggcgtgcgggcgaaggacgaggagacgggcgagaccttcgagatccgc
gcgcggtcggtcgtcaacgccacgggggtctacgtcgacgcggtgcggcggctcgaccag
cccgacgcctcggccctgctggccccgagccagggggcgcacatcgtgctggaccggtcg
ttcctgccgggcgatgcggcggtgatgatccccaagaccgacgacggccgggtcctgttc
gcgatcccctggcacgaccgcacgctcatcgggacgaccgacgtcccgctgtcggccacg
ccccgcgagccccggccgctggccgaggagctggagttcctgatggagcacgccgggcgg
tatctgagcaagacgccccgtcgcgaggacgtgcggagccagttcgccggcctccggccg
ctgatcaacgccgaggcggggcgcggcggccagaccaagaagctctcgcgcgagcacgcc
gtcgtcgtctcggactcgggcctgatcacgatcacgggagggaaatggaccacctaccgg
gtcatgggccgcgacgtcgtggaccacgcggccgaggtcggcggcctgccgcgcaagccc
agcaagaccgagtccctccatctccacggctggaccgaacaccccgccgcgaaggaggaa
accctggcgctctacggctccgaggcggccgacatccgggcgatcgtcgacgcatcgccc
gaagccggtcggaagctgcacgaacggctcccctacctcgaagccgaggtcgtctgggga
gtccgccacgaggccgcgaggacgatcgaggacgtcctgtcccggcgcacccgcgccctg
ttcctggacgcccgcgcctgcatcgaagccgccccccgggtcgccgcgatcatggccgag
gagctgggcgaggacgaggcctggcgcgatcgcgaggtctcgcggttcctcgccctggcc
gccacctacctcccggcgtccggcgagggatcgtga

DBGET integrated database retrieval system