KEGG   Purpureocillium lilacinum: VFPFJ_04904Help
Entry
VFPFJ_04904       CDS       T05029                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase E1 component, mitochondrial precursor
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
plj  Purpureocillium lilacinum
Pathway
plj00020  Citrate cycle (TCA cycle)
plj00310  Lysine degradation
plj00380  Tryptophan metabolism
plj01100  Metabolic pathways
plj01110  Biosynthesis of secondary metabolites
plj01130  Biosynthesis of antibiotics
plj01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:plj00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VFPFJ_04904
  Amino acid metabolism
   00310 Lysine degradation
    VFPFJ_04904
   00380 Tryptophan metabolism
    VFPFJ_04904
Enzymes [BR:plj01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     VFPFJ_04904
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 28887033
NCBI-ProteinID: XP_018179464
UniProt: A0A179H393
LinkDB All DBs
Position
Unknown
AA seq 1066 aa AA seqDB search
MLRNSLCRASSQLLRGARCPAVSSKRTLATTSASTSSWKLAAARRPLAVCAARSYATSAT
HSPPDPSDNFLSGSTANYIDEMYMQWKEDPKSVHVSWQVYFKNMESGDMPISQAFQPPPN
LVPNMTGGVPRLGGGLALEDGSDVTNHLKVQLLVRAYQARGHHKANIDPLGIRNTAAGFG
NIKPKELTLEHYGFGEKDLDTEYTLGPGILPRFKKDGREKMTLREIVAACEKIYAGAYGV
EFIHIPDREKCDWLRERLEVPQPFKYSIDEKRRILDRLIWSSSFESFLATKYPNDKRFGL
EGCETLVPGMKALIDRSVDYGVKDIVIGMPHRGRLNVLSNVVRKPNESIFSEFAGTGGAE
DEGSGDVKYHLGMNFERPTPSGKRVQLSLVANPSHLEAEDPVVLGKTRAIQHYNNDEKTH
RTAMSVLLHGDAAFAAQGVVYECLGFHSLPAFSTGGTIHLVVNNQIGFTTDPRFARSTAY
CTDIAKAIDAPVFHVNADDVEAVNFVCQLAADWRAEFQHDVVIDLICYRKHGHNETDQPS
FTQPLMYKRINSKEPQIDVYVNKLLQDGTFTKEDIEEHKQWVWGMLEESFDKSKDYQPTS
KEWTTSAWNGFKSPKELATEVLPHNSTAVDQKTLDHVGEIIGSAPEGFHIHRNLKRILNN
RTKSVVEGKNIDFPTAEALAFGTLVTEGYHVRVSGQDVERGTFSQRHAVFHDQETEETYT
PLQHISKDQGKFVISNSSLSEFGALGFEYGYSLSSPNALVMWEAQFGDFANNAQCIIDQF
IASGEVKWMQRTGLVMSLPHGYDGQGPEHSSGRLERYLQLCNEDPRVFPSPEKLARQHQD
CNMQIAYMTTPANLFHVLRRQMQRQFRKPLVIFFSKSLLRHPLARSSIEEFNGENAAFQW
IIPDPEHETGAIKAPEEIERVILCSGQVWAALHKHRADNKIDNVAFTRIEQLNPFPWQQL
KENLDMYPNAKTIVWCQEEPLNAGAWSFTQPRIETLLNQTKYHDRKHVMYAGRNPSASVA
TGMKRVHQGEEQDFLQMAFTVKQDKLKGEQSQTERLARKMAKIEFY
NT seq 3201 nt NT seq  +upstreamnt  +downstreamnt
atgttgaggaattcgctctgcagggccagctcccagctgctccgcggtgccagatgcccg
gccgtctcgtcaaaacgcaccctcgcgaccacgtcggccagcacctcgtcatggaagctc
gccgccgcccgcaggcccttggccgtctgcgccgcccgttcctacgcgacgagcgcgacg
cattcgccccccgaccccagcgacaacttcctctctggcagcaccgccaactacattgac
gagatgtacatgcagtggaaggaggaccccaagagcgtccacgtctcgtggcaggtctac
ttcaagaacatggagagtggcgacatgcccatctcccaggccttccagccgcccccgaac
ctggttcccaacatgaccggcggcgtccctcgtctcggcggcggcctggctctcgaggac
ggctccgacgtcaccaaccatctcaaggtccagctgctcgtccgcgcctaccaggcccgc
ggccaccacaaggccaacatcgacccccttggcatccgcaacaccgccgctggcttcggc
aacatcaagcccaaggagctgacccttgagcactacggcttcggcgagaaggacctcgac
accgagtataccctcggacccggcatcctgccgcgcttcaagaaggatggccgcgaaaag
atgacgctgcgcgagatcgtggctgcctgcgagaagatctatgccggcgcctacggcgtc
gagttcatccacattcctgatcgcgaaaagtgcgactggctgcgcgagcgcctcgaggtg
ccccagcccttcaagtactccattgatgagaagcgccggatcctcgaccgcctcatctgg
agctccagcttcgagtctttcctcgccacgaaataccccaacgacaagcgtttcggtctc
gagggctgcgagaccctggttcccggcatgaaggccctcatcgatcgcagtgtcgactac
ggcgtcaaggacattgtcatcggcatgccccatcgtggtagactcaacgtcctctccaac
gtcgtgcgaaagcccaatgagtcaattttctccgagtttgccggcactggcggtgccgaa
gatgagggctctggtgacgtgaagtaccatctgggcatgaactttgagcgcccgacgccc
tcgggcaagcgcgtgcagctttctctcgtcgccaacccgtcgcatctggaggccgaggac
ccggttgtgctcggtaagacccgtgccatccagcactacaacaacgacgagaagacgcac
cgcactgccatgagcgtgctgctccacggtgatgccgccttcgccgcccagggtgtcgtc
tacgaatgtctcggattccactcgctccctgccttctccacgggtggcaccatccacctg
gttgtcaacaaccagattggcttcaccacggaccctcgcttcgctcgctccacggcttac
tgcacggacatcgccaaggccattgacgcgcccgtcttccacgttaacgctgacgacgtc
gaggctgtcaacttcgtctgccagcttgccgctgattggcgcgccgagtttcagcacgat
gtcgtcatcgacctcatctgctaccgcaagcacggccacaacgagacggaccagccgtcg
ttcacgcagccgctcatgtacaagcgcatcaactccaaggaaccccagatcgatgtctac
gtcaacaagctgctccaggatggcaccttcaccaaggaggacattgaggagcacaagcag
tgggtctggggcatgctggaggagagcttcgacaagtccaaggactaccagcccacttcc
aaggagtggaccacgtcggcctggaacggcttcaagtcccccaaggagctcgccaccgag
gtcctgccgcacaactcgacggctgtcgaccagaagacgctggaccacgttggggagatc
atcggctctgctcccgagggcttccacatccaccgcaacctgaagcgcattctcaacaac
cgcaccaagtcggttgtcgagggcaagaacatcgacttcccgactgctgaggccctcgct
ttcggcaccctggtgaccgagggttaccacgtccgtgtttccggccaggacgtcgagcgt
ggcaccttctcccagcgccacgccgtcttccacgaccaggagaccgaggagacgtacact
cccctgcagcatatcagcaaggaccagggcaagtttgtcatttccaactcttccctgagc
gagtttggtgctcttggcttcgagtacggttactccctgtcgtcccccaacgcgctcgtc
atgtgggaggcccagtttggtgacttcgccaacaacgcgcaatgcatcatcgaccagttc
atcgcctcgggcgaggtcaagtggatgcagcgaaccggtctcgtcatgtcactgcctcac
ggctacgacggtcagggcccggagcactcctctggtcgcctggagcgatacctgcaactt
tgcaacgaggacccgcgcgtcttcccgtctcctgagaagcttgcccgccagcaccaggac
tgcaacatgcagatcgcctacatgacgacccctgccaacctgttccacgtgctgcgccgc
cagatgcagcgccagttccgcaagcctctggtcatcttcttctcaaaatccctcctgcgt
catcctctggctcgctccagcatcgaagagttcaacggagagaacgctgccttccagtgg
atcattcccgaccccgagcacgagaccggcgccatcaaggcgcccgaggagattgagcgc
gtcatcctctgcagtggccaggtctgggccgccctgcacaagcaccgcgcggacaacaag
atcgacaacgtcgccttcacccgcatcgagcagctgaaccccttcccttggcagcagctc
aaggagaacctcgacatgtaccccaatgccaagaccatcgtctggtgccaggaggagcct
cttaacgccggcgcctggagcttcacgcagccgcgcatcgagacgctgctgaaccagacc
aagtaccacgaccgcaagcacgtcatgtatgccggccgcaaccccagcgcgtcggtcgcc
acgggcatgaagcgcgtccaccaaggagaggagcaggacttcctgcagatggccttcacc
gtcaagcaggacaagctcaagggcgaacagtcacagacggagaggttggcgaggaagatg
gccaagatcgagttctactag

DBGET integrated database retrieval system