KEGG   Purpureocillium lilacinum: VFPFJ_07734Help
Entry
VFPFJ_07734       CDS       T05029                                 

Definition
(RefSeq) histone-lysine N-methyltransferase, H3 lysine-4 specific
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
plj  Purpureocillium lilacinum
Pathway
plj00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:plj00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    VFPFJ_07734
Enzymes [BR:plj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     VFPFJ_07734
Chromosome [BR:plj03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     VFPFJ_07734
   HMT complexes
    COMPASS/SET1 complex
     VFPFJ_07734
    COMPASS/SET1 complex (yeast)
     VFPFJ_07734
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET_assoc SET
Motif
Other DBs
NCBI-GeneID: 28889857
NCBI-ProteinID: XP_018176202
UniProt: A0A179H588
LinkDB All DBs
Position
Unknown
AA seq 1248 aa AA seqDB search
MTRTPPAVSFAQFFPNAAKVRAEADRPGRGPSAAAPPSSREPPAALGVDALTGIARPSHA
VSSLPDAPHTHGDDTANDSPTTEIPSTGGSSTSHASSASSIFSTSLKPPANAPASHLCAS
LPRDSLSHSPAPLQRPDMPASASAERPGQVYRDDRSKRGAEPSPRSGPPSDGRIPARDPL
PSVKGIKCTYDPILDRVRNKSVSKNAKPTYKEFGLDDDAPPSDPRLAKAGDRLGYINTDF
YLPKARLRHAPENLRPYPYDPKTSIGPGPPTQIVVTRYNPLVPFTKVTTVFATFGEIAES
SNKMHPDTGSYLGFATIRYRDSKRPGRPPVTAIDAARRAVRARGIRIDADIVKVDYDPEG
RKSRRMLEEHLKREREKLNREKPSRQTSSTPKPPPTGPKSSSAATPAPAFVRPPPTAPKG
PSAQRQPTTTTPQQQPTVAVTPRGVELHSIAPQIADQPYVFVTAESVPVLPSIIPHMKKR
LKNYAFEDIRLDRTGFYIVFRNSFTGKSEAERCFRGANHTEFFTYDMAMQLCLPRPPARS
TDNAPKRTPSPDRSQRPAYRRRDDEAARRRREEEADLEEEKKQRAKNFDPVIEAVEVVRR
EMTEHLIRHIRTQVAAPCLADFLDPANHVAKRRKLNLDQPDDDEELAFDDGSASPRIGTP
NSRTDPIERRTGTFEAKLLPRIRKNKSKGQAHRSTFVDPFSRSRPSVARAAFRSLHHRLK
SLDSDFESDDETDAGALAARETEEPESRPRSRMSTDDEASKDDFGSWSRQEDDSMTEASL
AVPDGILPRKRKLEETIETALKRQKKSDEELFGVKIGRLEAEVNGRATSEDVGFDIDSSV
SRSETPASQTAKGLKKKPTKQKKKTKKQLFEEREALKRQQDVESQADEDEAPPVPTKSEG
QELLPPAPEAKVEKHDDRFFSTEALTAALTLPDGFKPDISSLQSLALGSKDLPDLARLQK
KYATAEIGNAELWLWKRNRIRELNSSDGSVDRPISIGGYYVPNATGCARTEGVKKILNSE
KSKYLPHHIKVQKAREEREARFKKTGKDASAAEAARLAAEKLIAKGNSRANRASNRRYVA
DLNDQKKTLGQDSDVFKFNQLKKRKKPVKFARSAIHNWGLYAMENIAKDDMIIEYVGEEV
RQQISEIREKRYLKSGIGSSYLFRIDDDTVVDATKKGGIARFINHSCMPNCTAKIIKVEG
SKRIVIYALRDIALNEELTYDYKFEREIGSLDRIPCLCGTPACKGFLN
NT seq 3747 nt NT seq  +upstreamnt  +downstreamnt
atgactcgcaccccgccggccgtgagtttcgctcaattcttccctaacgctgccaaggtc
agggccgaagccgaccgccctgggcgcggcccctcggccgccgctccgccgtcgtcgcgc
gagcctcctgccgcgctcggcgtcgacgcgctgactggcatcgcccggccctctcacgcc
gtgtcttccttgcctgacgcaccacacacccacggcgacgataccgccaacgactcacca
accaccgagataccaagcaccggcggatcctccacatcccacgctagctctgcctcatcc
atattcagcacctcgctgaagcccccggcaaatgcgcccgcctctcacctctgcgcgagc
ctgcccagagactcgctttcacactccccggccccgctgcagagaccagacatgcccgcg
tccgcgtctgccgagcggccgggccaggtctaccgcgatgatcgatccaagcgcggcgct
gagccctcgcctcggagcggccccccgtccgacgggcgcatccccgctcgagatcctctg
ccatccgtcaaaggcatcaagtgcacatatgacccgatcctcgatcgagtacgcaacaaa
agcgttagcaagaacgccaaaccgacctacaaagaattcggattggatgatgacgctccc
ccttcagacccgcggctggccaaggctggcgacaggctaggctacatcaacaccgacttc
tatctgcccaaagcacgcctgcgccatgcccccgagaacctcaggccgtatccctacgac
ccgaagacgtccatcgggccgggaccgcctacgcagattgtcgttacccgctacaacccc
ctcgttccgtttaccaaagtgacgaccgttttcgccacgtttggtgagattgcggaaagc
agcaataagatgcaccctgataccggcagctacctggggtttgcgacaatccgctaccga
gacagcaaacgcccaggccgacctcccgtcactgccatcgatgccgcccgccgtgctgtt
cgcgcccgcgggatcaggatcgatgccgacattgtcaaggtggactatgacccagaaggt
cgcaagagccgacgcatgctcgaggaacacctaaagcgcgagagagagaagctcaaccga
gaaaagccttcgcggcaaacctcgtccactccgaagccaccccccacgggcccaaagtcg
tcttcggccgctacgcccgcacctgctttcgtgcgcccccctccgacagcgccaaagggt
ccttctgcgcagaggcaaccgacgacgacgacgccacaacaacagccgacagtcgccgtg
acacctcggggtgttgaattgcacagtatcgcaccgcagattgccgaccaaccctatgtc
ttcgttaccgcagaaagcgtacccgttttgcctagtatcattcctcacatgaagaagcgg
ctcaagaactacgcgtttgaggacatacggttggacagaactggcttttacatcgtattc
cgcaactccttcactggcaagtcagaggccgagcgatgcttccgaggtgctaatcacacc
gaattcttcacctatgacatggcaatgcagctttgcttgccgcgcccgcctgcacgttcc
accgacaacgcgccgaagcgaaccccgagtccagacaggagtcagcggccagcatatcga
cgacgagacgacgaggcggccagacggcgacgggaagaggaggcagacttggaagaggag
aagaagcaacgggccaaaaacttcgatccagtcatcgaggctgtcgaggtcgtgcgcagg
gaaatgacggaacatctcattcgccatatccgcactcaagtagcagcaccctgccttgca
gacttcctggacccggccaaccacgttgccaagagaaggaagctcaaccttgatcagcct
gacgatgatgaggagttggctttcgacgacggcagtgctagtccgcggattgggacaccg
aattccaggacggatcccatcgaacgtcgcacggggacctttgaggcaaaattgttgcct
aggattcgcaagaacaagagcaaggggcaggcccaccgcagcacgttcgtcgaccccttt
tcaagaagtcgaccctctgtggcccgcgctgcatttaggtctttgcaccatcgccttaag
agccttgatagcgacttcgagtccgatgacgagactgatgctggagccctggcggcccgg
gagaccgaggagcctgagtcgcggccgcgcagccgcatgagcacggacgatgaagcttcc
aaggatgactttgggtcttggagtcgccaagaggacgattccatgacggaggcgagcctg
gccgttcccgatggcatactgccaaggaagcgcaagctggaagagaccattgagacagcc
ctcaaacgccaaaagaaatctgatgaagagctcttcggcgtcaagattggccgtctcgag
gctgaagtcaacgggcgcgcgacctcggaggatgttgggttcgacatcgacagcagtgtc
tctcgttccgagacgcccgcttcccagactgcaaagggtctgaagaagaagccaacaaag
cagaagaaaaagaccaagaagcagctattcgaggagcgtgaagccttgaaacggcagcag
gacgttgagtctcaagccgacgaggacgaggcgcccccagtaccaaccaaatctgaggga
caagaactcctcccgccagccccggaagccaaggtcgagaagcacgacgacaggttcttc
tccacagaagccctgactgcggcactcacgctccccgatggcttcaaacccgacatctct
tcactgcagagcttggcgttggggtcgaaagacctgccggatctggcaagacttcagaag
aaatacgcgacagccgagattggaaatgcggagctgtggctctggaagcgcaaccgcatc
agagagctcaattcgtccgatggctcagtggaccggccaatttcgattgggggctactat
gtgcccaatgctacgggctgtgctcgtactgagggtgtgaagaaaattctcaattccgag
aagtccaagtatttgccacaccacatcaaggtccagaaggcccgagaggagcgcgaagcc
cggttcaagaagacgggcaaggacgccagcgccgccgaggctgccagattggccgcggag
aagctcatcgccaagggcaactctcgagccaaccgtgccagcaaccgacgatacgtcgcc
gatctgaacgatcagaagaagactctgggccaggactcggacgtgttcaagttcaaccag
cttaagaagcggaagaagcccgtcaagttcgcccggtccgccattcataactgggggctc
tacgccatggagaatatcgccaaggacgacatgattatcgagtatgttggcgaggaggtg
cggcagcagatatcggagatccgcgagaagcgctatcttaagagtggcattgggagcagc
tatctgttccgcatcgacgacgacaccgtcgtcgacgccaccaagaaggggggcattgcg
cgattcatcaaccacagctgcatgccgaactgcacggcaaagatcatcaaggtcgagggc
agcaagcgaatcgtcatatatgccctccgtgacattgctctgaatgaggagttgacctac
gactacaagttcgagcgagagataggcagcttggaccgcattccctgtctctgcggcact
ccggcatgcaagggcttcctcaactaa

DBGET integrated database retrieval system