KEGG   Plantactinospora sp. KBS50: CIK06_04825Help
Entry
CIK06_04825       CDS       T05048                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
plk  Plantactinospora sp. KBS50
Pathway
plk00620  Pyruvate metabolism
plk00680  Methane metabolism
plk01100  Metabolic pathways
plk01120  Microbial metabolism in diverse environments
plk01200  Carbon metabolism
Module
plk_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:plk00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CIK06_04825
  Energy metabolism
   00680 Methane metabolism
    CIK06_04825
Enzymes [BR:plk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CIK06_04825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase Phage_TAC_6
Motif
Other DBs
NCBI-ProteinID: ASW53662
UniProt: A0A248YJA6
LinkDB All DBs
Position
complement(1034061..1036853)
Genome map
AA seq 930 aa AA seqDB search
MTDHHHPGGPDAALRADIRRLGTLLGQTLARQEGPPLLDLVEEVRALVRTDADAEAAAAR
LGAMDIATGTKLARAFSTYFHLANITEQVHRARDLRRQRAVNGGWLDQAASLIAERGVPA
DEIAEAARRLAVRPVFTAHPTEAARRSILTKLRAIADELDAEAAAAILYGAADEGPANRR
LAELLDLLWQTDELRLDRPDPTDEARNAIYYLRDLYAEAAPQVLDNLADTLRGLGVETPP
TARPLTFGTWIGGDRDGNPFVTPQVTREVLHIQYEHGLTATEQAMDALINEVSVSRRLRG
VSLDLSASLAKDLDALPEVATRFRRVNAEEPYRLKARCVLAKLANTRRRLRQGTPHVPGR
DYRGSAELIGDLELMRASLARNAGQLTAMGRLASAIRTISSFGLHLATMDIREHAEAHHA
VLAQFYSHVGEATDYPGLGRAERAKLLSEELTGRRPLAAVDTPLTEAARKTFDVFAAIRE
TQERFGEEVIESYIISMTLGVDDVLAAVVLAREAGLVDVHSGRARIGFVPLLETPAELNA
GGELLDELLSLPAYRAVVAARGHVQEVMLGYSDSNKEAGITTSQWSIHRAQRALRDVAAR
HGVRLRLFHGRGGTVGRGGGPTHEAILAQPYGTLDGAIKVTEQGEVISDKYSLPSLAREN
LELTIAAVLQSALLHTAPRQPAEQLERWDATMDVVSEAAFRSYRSLVENPDLPAYFWAAT
PTELLGALNIGSRPAKRPNTGAGLAGLRAIPWVFGWTQTRQIVPGWFGVGSGLAAARAAG
HGDILAEMHRSWHFFRTFLSNVEMMLTKTDLTIARRYVETLVPEPLHPIFETISEEYELT
KREVLAITASPALLENSPVLQRTLAVRDTYLRPLHHLQVALLRQYRESGLAGRAVATAPG
GRRAPGEGTALERALLTTVNGIAAGMRNTG
NT seq 2793 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaccaccatcaccccggcggcccggacgccgcacttcgggcggacatccgccgg
ctcggcacgctgctcgggcagaccctcgcccggcaggagggcccgccgctgctggacctc
gtcgaggaggtccgggcgctggtccgcaccgacgccgacgccgaggccgcggcggcccga
ctgggcgccatggacatcgccaccggcacgaagctggcccgggccttctccacctacttc
cacctggccaacatcaccgagcaggtgcaccgggcccgggacctgcgccggcagcgggcc
gtcaacggcggctggctggaccaggcggcatcgctgatcgccgagcgcggcgtaccggcc
gacgagatcgccgaggcggcccggcggctggccgtccggccggtcttcaccgcacacccc
accgaggccgcccgccggtcgatcctgaccaagctgcgggccatcgccgacgaactggac
gccgaggccgccgccgcgatcctgtacggcgccgccgacgagggcccggccaaccgccgg
ctcgccgaactgctcgacctgctgtggcagaccgacgaactgcggctggaccgtccggac
ccgaccgacgaggcccgcaacgccatctactacctgcgcgacctgtacgccgaggccgca
ccgcaggtgctggacaacctcgccgacaccctgcgtgggctgggcgtggagaccccgccc
acggcccggccgctcaccttcggcacctggatcggcggggaccgggacggcaacccgttc
gtcaccccccaggtgacccgcgaggtgctgcacatccagtacgaacacgggctcaccgcc
accgagcaggcgatggacgcactgatcaacgaggtgtcggtgtcccgccggctgcgcggg
gtgtccctggacctgtcggccagcctggccaaggacctcgacgcgctgcccgaggtggcc
acccggttccgccgggtcaacgccgaggagccgtaccggctcaaggcgcgctgcgtgctg
gccaagctcgccaacacccggcgccggctgcggcagggcaccccacacgtaccggggcgc
gactaccggggcagcgccgagctgatcggcgacctggagctgatgcgcgcctcgctggcc
cgcaacgcgggccagctcaccgccatgggccggctggcctcggcgatccggaccatctcc
agcttcggcctgcatctggccaccatggacatccgggagcacgccgaggcgcaccacgcg
gtgctcgcgcagttctacagccacgtgggcgaggcgaccgactaccccgggctgggccgg
gccgaacgggcgaagctgctctccgaggagctgaccggccgccggccgctggccgccgtg
gacaccccgctcaccgaggccgcccgcaagaccttcgacgtgttcgcggcgatccgggag
acgcaggaacgcttcggcgaggaggtcatcgagtcgtacatcatctcgatgaccctcggc
gtggacgacgtgctcgcggccgtggtgctggcccgggaggccgggctggtggacgtgcac
agcggccgggcccggatcggcttcgtgccgctgctggagacgccggccgagctgaacgcc
ggcggcgaactcctggacgagctgctgtcgctgcccgcgtaccgggccgtggtcgccgcc
cgcggccacgtgcaggaggtgatgctcgggtactccgactccaacaaggaggccgggatc
accacctcgcagtggtcgatccaccgggcgcagcgggcgctgcgcgacgtggccgcccgg
cacggcgtgcggctgcgcctgttccacggccggggcggcaccgtcgggcggggcggcggc
cccacccacgaggcgatcctggcccagccgtacggcacgcttgacggtgcgataaaggtc
accgagcagggcgaggtgatctccgacaagtacagcctgccctcgctggcccgggagaac
ctggagctgaccatcgccgcggtgttgcagagcgcgctgctgcacaccgcgccccggcag
ccggccgagcagttggagcgctgggacgcgaccatggacgtggtctccgaggccgccttc
cggtcgtaccgctcgctcgtggagaaccccgacctgccggcctacttctgggcggcgacc
ccgaccgagctgctcggcgcgctgaacatcggctcccggccggcgaagcggccgaacacc
ggcgccgggctggccgggttgcgcgcgatcccgtgggtcttcggctggacgcagacccgg
cagatcgtgcccggctggttcggcgtgggctccggcctggccgccgcccgcgcggccggc
cacggcgacatcctggccgagatgcaccgcagctggcacttcttccgcacgttcctgtcg
aacgtcgagatgatgctgaccaagaccgatctcacgatcgcccgccggtacgtcgagacc
ctggtgcccgagccgctgcacccgatcttcgagacgatctccgaggagtacgagctgacc
aagcgcgaggtgctggccatcaccgcgtccccggcgctgctggagaactcgccggtgctg
caacgcacgctcgcggtccgggacacctacctgcggccgctgcaccacctccaggtggcg
ctgctgcgccagtaccgcgagtccgggctggccgggcgggcggtggccaccgcgccgggc
ggccggcgggcacccggcgagggtacggcgctggagcgcgccctgctcaccacggtcaac
ggcatcgccgccggcatgcgcaacaccggctga

DBGET integrated database retrieval system