KEGG   Planctopirus limnophila: Plim_3447Help
Entry
Plim_3447         CDS       T01225                                 

Definition
(GenBank) glycosyl hydrolase BNR repeat-containing protein
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
plm  Planctopirus limnophila
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:plm00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Plim_3447
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Plim_3447
Enzymes [BR:plm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     Plim_3447
Bacterial toxins [BR:plm02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   Plim_3447
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4457969..4459648
Genome map
AA seq 559 aa AA seqDB search
MQCLLTRICLAVTLGCMTSMNMLGLMASEPEVTTSVVVYSGKAAELKWIGKPWASIEDPK
GSTSALLASGQNRWLLSRSGIGAGDFQIRVRLQLAKLDGTAAAFDFGSSRFGLDGKAGLL
FVEGPLFRNQPAATLKIADLVQPGAPFLLEVIRKDEQTRFLINGQSVYTLDGWKGSVGRV
GLRPWRNEMAVFDFSIKGNLYELPAPPEPLFPSGFAGGTEGYHTFRIPSLTTTRSGTLLA
LCEGRKNSTGDSGDIDLVMKRSTDGGKTWSQPVVLWDNGENTCGNPCLVVDQTTGELLLL
ATWNLGDDHESEIIAQTSRDTRRVYVLRSKDDGLTWSQPVEITKDVKQPDWTWYATGPGG
GIQIQQGSHAGRLVIPCDHIEARTKKYYSHVIYSDDHGQTWKLGGSTPAAGVNECEVVEL
TGGKLLLNMRNASASRQRQTSMSEDGGLTWSELKSDAALIEPVCQAAILRASWPARSEPG
WILFSNPASTTSRTNLTVRGSRDDGQTWPVSKVLYTGPAAYSDLALLPDGKVGCLFEAGE
ANYAESIVFVTFGLDELTT
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgcaatgcctgctgacgaggatctgcctggcggtcacactgggctgcatgacctcgatg
aacatgcttggtttgatggcctcagagccagaggtcacaacttcggtcgttgtctattcc
ggcaaggcggctgagttgaaatggattggtaagccttgggcatcgatcgaggatcccaag
ggctcaacgagcgcactgctggcgagtggtcagaatcgatggctgctctctcgaagcggg
attggcgcaggtgattttcagattcgagtgcggctgcagctggccaaactggatggaacg
gctgccgccttcgatttcggaagcagccgctttggtctcgatggcaaagcgggcctgctg
tttgttgaagggccactctttcgcaatcaaccagctgcgacgctcaaaatcgcagacttg
gtacagccgggtgctccgttcttgcttgaagtgattcgaaaggatgaacaaacccggttt
ctgatcaatggccagtcggtctacacactagatggctggaaaggctctgtcggtcgagtg
gggttgcggccgtggcgcaatgagatggcggtgtttgacttctcgatcaaaggaaatctt
tacgagttgccagcaccacctgagcctttgtttccaagtggctttgcaggtggaacggag
ggctatcacacctttcggatcccttctctgacaaccacgcgctcgggaacgttattggcc
ctttgcgaaggacgaaaaaactcgacgggcgatagcggcgatatcgacctcgtcatgaag
cgatcgaccgatggaggaaagacatggagccagcccgtcgtcctctgggataatggcgag
aatacttgcggcaatccgtgcctggtcgtcgatcaaacgaccggagaattattgctcctg
gcaacctggaacctgggtgatgatcacgagagcgagatcattgcccaaaccagccgcgat
acccggcgtgtgtacgttctgcgatccaaagacgacggcttgacctggagccagccggtg
gagatcaccaaagatgtgaaacaacccgactggacgtggtatgcgacagggccgggtggc
ggaattcaaattcagcagggctcccacgcgggtcgattggtcataccctgtgaccatatt
gaagccagaacgaaaaagtactactcgcacgtgatctactcggatgatcatgggcagacc
tggaaacttggcggaagcacgccagccgccggtgtgaatgaatgcgaggttgtcgaactg
actgggggaaaactgctgctcaatatgcgtaatgccagtgccagcaggcagaggcaaacg
agtatgagcgaggatggcggcctcacctggagtgaattgaaatctgacgcggcactcatc
gagcctgtctgccaggcagccatcctgcgagccagttggcctgccaggtcagagccgggc
tggatcctcttcagcaaccctgccagcaccactagccgcacaaatttgacagttcgcggc
agtcgggatgacggccagacctggcctgtcagcaaagttctgtatacgggcccagcggct
tattctgacctggctttacttcctgatggaaaagtcggctgcctgtttgaagcgggtgaa
gccaactacgccgagtcgatcgtctttgtgacattcgggctggatgaattaacaacgtga

DBGET integrated database retrieval system