KEGG   Planctomyces sp. SH-PL14: VT03_17625Help
Entry
VT03_17625        CDS       T04354                                 

Gene name
nedA
Definition
(GenBank) Sialidase precursor
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
pls  Planctomyces sp. SH-PL14
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:pls00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    VT03_17625 (nedA)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    VT03_17625 (nedA)
Enzymes [BR:pls01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     VT03_17625 (nedA)
Bacterial toxins [BR:pls02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   VT03_17625 (nedA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4505493..4506701
Genome map
AA seq 402 aa AA seqDB search
MRALLSFVLLLGTAPAVAHAAEPRFDQHDLFTAGSAGYQLYRIPGVVVTNKGTVLAYCEA
RKSDKGDWGTINVQLRRSTDGGTTWSEPKTISDVPGPKVKNPVAVAKKLGGDGEVTYNNP
VLIVDRKTGAVHFLFCLEYMRCFYARSEDDGQTFSPPVEITQSFEAFRPHYDWKVLATGP
AHGIQLTSGRLVVPVWLSLGTGGHAHRPSVTSTIYSDDHGATWKAGEIAVPNTEEWVNPN
ETVVAQLVDGRVMLNVRSESKPHRRLVTTSPDGIGGWTPAKFDDTLLEPICMASLVRLTG
KESDKTRLLFTNPATVDARKKITVRMSYDEGTTWPVSRMVEEGFSGYSDMAILPDHTVVM
VYERGSVDNQSPYKSGSLTVARFNVEWLSEGKDRIAAAGALR
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgctctgctctctttcgtgctccttctcggaacagctccggccgtcgcccacgcc
gcggagccgcggttcgaccagcacgatctgttcacggccggcagcgccggataccagctc
taccggattcccggcgttgtcgtgacgaacaagggaaccgtgctcgcctactgcgaagcc
cgcaagagcgacaagggggactgggggacgatcaacgtccagcttcggcggagcaccgac
ggcggcactacctggtccgagccgaagacgatttccgacgtccccggccccaaggtcaag
aacccggtcgcggtcgcgaagaagctcggcggcgacggcgaagtgacctacaacaacccg
gtcctgatcgtcgaccggaagaccggcgcggtccacttcctgttctgcctggagtacatg
cggtgcttctacgcccgcagcgaggatgacggccagacgttctcgccccccgttgagatc
acgcagtccttcgaggcctttcgcccgcactacgactggaaggtcctggcgaccggtccc
gcccacggcatccagctcacctcggggcggctcgtcgtgccggtctggctatcgctcgga
accggggggcacgctcatcgcccctccgtgacgtcgacgatctacagcgacgaccacggc
gccacctggaaagccggggagatcgcagtcccgaataccgaggaatgggtcaacccgaac
gaaaccgtcgtggcccaactggtcgatggccgcgtgatgctcaacgtccggagcgagtcg
aagccgcaccgccgcctcgtgacgacgagcccggacggaatcggggggtggacccccgcg
aagttcgacgacacgctcctggaaccgatctgcatggcgagcctcgtccggctgacgggg
aaggagtccgacaagacgcggctgctcttcaccaacccggcgacggtcgacgcccggaag
aagatcaccgtccggatgagctacgacgaagggacgacgtggccggtctcccggatggtc
gaggaggggttcagcggctactccgacatggcgatcctgccggaccacacggtcgtgatg
gtttatgagcgggggagcgtcgacaaccagtctccgtacaagagcggctcgctgacggtg
gcccggttcaacgtcgagtggctgtcggaggggaaggatcggatcgcggcggccggcgcc
ttacggtag

DBGET integrated database retrieval system