KEGG   Paenibacillus larvae: ERIC2_c07530Help
Entry
ERIC2_c07530      CDS       T02963                                 

Gene name
sodA2
Definition
(GenBank) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
plv  Paenibacillus larvae
Brite
Enzymes [BR:plv01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     ERIC2_c07530 (sodA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(727346..727960)
Genome map
AA seq 204 aa AA seqDB search
MAYQLPALPYANNALEPHIDETTMMIHHDRHHNTYVTNLNAALEGHDNLSSKSVEDLISD
LNSVPENIRTAVRNNGGGHANHSLFWKLLSPNGGGKPAGALAQAIDQELGGFEKFKEDFA
KAATTRFGSGWAWLSVDKAGKLVVHSTGNQDNPLMEGLTPVLGIDVWEHAYYLKYQNKRP
DYIAAFWNVINWDEANKQYEAAKK
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggcttaccaattaccagcactaccttatgctaacaatgctttggaaccccacattgat
gaaactaccatgatgatccatcacgatcgtcatcataacacttatgtcactaatctgaat
gcggctttggaaggtcacgataacctttcctccaaatctgtggaagatctgatcagtgat
ttgaacagcgttccagaaaatatccgtacagctgtacgtaataacggcggtgggcacgct
aaccactccctcttctggaaattgctaagccctaatggcggcggaaagcctgcaggcgct
ctggctcaggctattgatcaggaactgggtggatttgagaaattcaaagaagattttgct
aaagcagcaacaacccgctttggaagcggctgggcatggctgagcgtagacaaagcaggc
aaactggttgtccacagcacgggtaaccaggacaacccgctgatggaaggcttgactcct
gttttgggtatcgacgtatgggaacatgcttactacctgaaatatcaaaacaaacgccct
gattacatcgccgcattctggaatgtaattaactgggacgaagccaacaaacaatacgaa
gctgccaagaaatag

DBGET integrated database retrieval system