KEGG   Pseudoalteromonas luteoviolacea: S4054249_13475Help
Entry
S4054249_13475    CDS       T04577                                 

Definition
(GenBank) peptidyl-dipeptidase
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
plz  Pseudoalteromonas luteoviolacea
Brite
Enzymes [BR:plz01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     S4054249_13475
Peptidases [BR:plz01002]
 Metallo Peptidases
  Family M2
   S4054249_13475
Exosome [BR:plz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   S4054249_13475
CD molecules [BR:plz04090]
 Proteins
  S4054249_13475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1:3170199..3172013
Genome map
AA seq 604 aa AA seqDB search
MSAKFKLSLSAIFVAGVLSLSGCNSTTTTEKLTEKDAEVFLAEAEKQLQDLSVRSGRAAW
IYANFITEDTAALSAEVSREYTAALVALANEAAKFDDLELNYDNRRKLDKLKLNLTLPAP
KDPQKTAKLAKLSAELDGLYGKGKYCNNGTCMSLGDMTAKMATSRNYEELLNIWQGWREV
SKPMRPLYKDLVSLANEGANELGYADTGAMWRSKYDMPADDFAKELDRIWGQVKPLYNSL
HCHVRAKLGEKYGEDKVPQDQPIPAHLLGNMWAQTWGNVYDLVAPENADPGYDLTQLLKE
HDYDAIKMTKGAEKFFTSMGFEPLPETFWTRSLFLKPQDRDVQCHASAWNLDNKDDLRIK
MCIQQTGEEFSVIHHELGHNFYQRAYNKLPLYYQESANDGFHEAIGDTIALSVTPGYLKE
IGLLEQVPDESKDIGLLMKMAMDKVAFIPFGLLVDQWRWKVYSGEISPEQYNQAWWELRE
KYQGVKSPVARSENDFDPGAKYHVPGNVPYTRYFLAHILQFEFHKSLCEIAGSKEAIHRC
SVYNSKEAGERLNTMLEMGSSRPWQEALEIVTGNQQMDATAILDYFAPLQAYLDEQNKGR
QCGW
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcaaaatttaaactcagcctaagcgcaatctttgtcgctggggtactctcactg
agtggctgtaactccacaacgacgactgaaaaactaactgaaaaagacgccgaagtattc
cttgccgaagccgaaaaacaactacaagatttatctgtaagaagcggccgagctgcgtgg
atttatgctaatttcattactgaagacaccgctgcgctatctgcggaagtaagcagagaa
tacacagcagcacttgttgcgctagccaacgaagccgctaaatttgatgacttagaatta
aattacgacaatcgtcgaaaacttgataagttaaagcttaacttaacacttcctgctcct
aaagatccgcaaaaaacagcaaagcttgcaaagctatcagctgaactagatggtctttat
ggtaaaggtaagtactgtaataacggtacttgtatgagcctaggtgacatgacagctaaa
atggccaccagccgaaattacgaagagctgctaaatatctggcaaggctggcgcgaagta
tcaaagccaatgcgtcccctctacaaagatcttgtatcattggccaacgaaggcgctaac
gaacttggctatgctgacacaggcgcaatgtggcgtagcaaatacgacatgccggcagat
gattttgcaaaagagttagaccgcatttggggtcaggtcaaacctctttataactcacta
cattgccatgtgcgcgcaaaacttggtgaaaagtatggtgaagacaaagtaccacaagac
caacctatccctgcgcacctgttaggtaatatgtgggcacaaacttggggcaacgtgtat
gacttggttgcgccagaaaacgccgatccaggttatgatttaacccagctacttaaagag
catgactacgatgcgattaagatgaccaaaggcgctgaaaagttctttacctctatgggt
tttgaacccctacctgaaacattttggacacgttcacttttcttaaagccacaagatcgt
gatgttcaatgtcacgcatcggcttggaatctagataacaaagacgatctgcgtatcaaa
atgtgtatccagcaaactggtgaagagttttcagttattcaccatgagttaggtcataac
ttttatcaacgtgcttacaacaagttacctctgtactatcaagaaagtgccaatgacggt
ttccacgaagccattggtgataccatcgcgctctccgtaacgccgggttatttaaaagaa
atcggattgctagagcaagtacctgatgaatcaaaagacattggcttattgatgaaaatg
gcgatggataaagtggcatttattccatttggtttgttagtagaccagtggcgctggaag
gtatactcaggtgaaatcagcccagaacaatacaaccaagcatggtgggaattacgtgaa
aagtatcaaggtgtaaaatcgcctgtagcacgcagcgaaaacgactttgacccaggtgca
aaataccatgtaccaggcaatgtaccttacactcgctatttcttagcacatatcttacag
tttgaattccacaaatcactgtgtgaaattgcaggcagtaaagaagcaattcaccgctgc
tctgtttacaactcaaaagaagctggtgagcgtttgaataccatgctggaaatgggcagc
agccgcccttggcaagaagcactcgaaattgttacaggcaaccagcagatggatgcaacg
gcgattttagattactttgcaccgttacaagcttacctagatgagcaaaacaaaggccgt
cagtgtggttggtaa

DBGET integrated database retrieval system