KEGG   Pseudoalteromonas luteoviolacea: S4054249_18760Help
Entry
S4054249_18760    CDS       T04577                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
plz  Pseudoalteromonas luteoviolacea
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:plz00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    S4054249_18760
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    S4054249_18760
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    S4054249_18760
Enzymes [BR:plz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     S4054249_18760
Peptidoglycan biosynthesis and degradation proteins [BR:plz01011]
 Precursor biosynthesis
  Amino acid ligase
   S4054249_18760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1:complement(4358906..4359814)
Genome map
AA seq 302 aa AA seqDB search
MSKFGKVAVLLGGSSAEREVSLASGNAIVEALKKQGVDVIAFDPAQRSVSELTSLNVKRV
FIALHGRGGEDGTVQGALEFMGIPYTGSGVLGSALAMDKIRCKHLFESAKLSTARYAVVD
RHSGYDAKAIINELGQVMVKPSHEGSSVGMAKAHDETSLIEALNAAFKFDNQVLVEQWIE
GREFTVSILDGEALPVIEMRTPRGFYDYQAKYKENSTEYICPAELNPAHTEQLQVMSLHA
FELVGASGWGRVDAMQDANGQFYLLEVNTVPGMTETSLVPKAAKSEGISFEQLVVRILEQ
TL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaatttggtaaagtagctgttttacttggtggcagttcagcagaacgagaggtg
tcattagcttctgggaatgcaattgtcgaagcgcttaaaaagcaaggggttgatgttatt
gcatttgatccggcacagcgtagtgtttctgagcttacttcactgaatgttaaacgtgtt
tttattgctttgcatggcagaggcggcgaagatggcacggtgcaaggtgcactggagttt
atggggatcccatatactggtagcggggtgctgggaagtgctttggctatggataaaatt
cgctgtaagcacttatttgaatccgcaaagcttagtactgctagatatgccgttgtcgac
aggcacagtggctatgatgccaaggccattataaacgaacttgggcaagtgatggtaaag
ccaagtcatgaggggtccagtgttggtatggcgaaggcgcatgatgaaacctcattaata
gaagcattaaatgcggcctttaaatttgataatcaggtgttggtagagcagtggattgaa
gggcgtgaatttacggtgagcatattagatggtgaagcattgcctgttattgaaatgcgt
acgccgcgagggttttacgactaccaagctaaatataaagaaaattcaacagagtatatt
tgtcctgctgaattaaaccctgcacatacagaacagcttcaggtcatgtcgttacatgca
tttgagttagttggtgcgagtggttggggccgtgttgatgcgatgcaagatgcgaatggt
caattttatttattagaagtaaatacagtacctgggatgactgaaacgtctttggtgcct
aaagctgcaaaatcagagggtattagctttgagcagttagtcgttcgcattttggagcaa
acgttataa

DBGET integrated database retrieval system