Parus major (Great Tit): 107200170 Help Entry 107200170         CDS       T04864                                  Symbol ELOC Name (RefSeq) elongin-C isoform X1   KO K03872   elongin-C Organism pmaj  Parus major (Great Tit) Pathway pmaj04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:pmaj00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     107200170 (ELOC)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pmaj04121]     107200170 (ELOC)    03400 DNA repair and recombination proteins [BR:pmaj03400]     107200170 (ELOC) Ubiquitin system [BR:pmaj04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    Cul2 complex     Adoptor protein      107200170 (ELOC)    Cul5 complex      107200170 (ELOC) DNA repair and recombination proteins [BR:pmaj03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      107200170 (ELOC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Motif Other DBs NCBI-GeneID:  107200170 NCBI-ProteinID:  XP_015473744 Ensembl:  ENSPMJG00000005239 LinkDB All DBs Position 2:complement(119814387..119828591) Genome browser AA seq 112 aa AA seqDB search MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEV NFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atggatggagaagagaaaacgtacggtgggtgtgagggcccagatgctatgtatgtgaag ttaatatcctctgatggccatgagttcattgtaaaaagagagcatgcattaacatcagga acaataaaagctatgttgagtggaccaggtcagtttgcagaaaatgaaacgaatgaggtc aattttagagagatcccatcccatgtcctatccaaagtatgcatgtatttcacctacaag gtccgctatactaacagctctacggagattcctgaattcccaattgcacctgaaattgca ctggaacttctgatggctgcaaacttcttagattgttaa

DBGET integrated database retrieval system