KEGG   Prochlorococcus marinus NATL1A: NATL1_20211Help
Entry
NATL1_20211       CDS       T00467                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pme  Prochlorococcus marinus NATL1A
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pme00001]
   00620 Pyruvate metabolism
    NATL1_20211 (ppc)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    NATL1_20211 (ppc)
   00680 Methane metabolism
    NATL1_20211 (ppc)
Enzymes [BR:pme01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     NATL1_20211 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
LinkDB All DBs
Position
complement(1663493..1666477)
Genome map
AA seq 994 aa AA seqDB search
MLKNPSNENISNHSTVCVEDQDPGSLLQQRLELVEDLWKTVLKSECPPDQTERLLRLKQL
SDPSKSNQDNSSKAIVQLITKMDLAEAISAARAFSLYFQLVNILEQRIEEDSYLESIEKG
KLDTSNYKIDPFAPALASQTAPATFTQLFERLRRLNVPPAQLDGLMREMDIRLVFTAHPT
EIVRHTVRHKQRRVATLLQQLQSNSLISESEKEIFRLQLEEEIRLWWRTDELHQFKPTVL
DEVDYALHYFQQVLFDAMPQLRRRLTTALASSYPDVEIPNEAFCTFGSWVGSDRDGNPSV
TPEITWRTACYQRQLMLDRYIASVQDLRDQLSISMQWSQVSSPLLESLEMDRVRFPEVYE
ERAARYRLEPYRLKLSYTLERLRLTQLRNKQLADAGWQFSPDGKPQISTNNSFDEVLHYK
SVEELKNELELIRNSLVSTDLTCEPLDTLLNQVHIFGFSLASLDIRQESTRHSDALDELT
RYLDLPESYGVMSEESRVQWLMKELRTRRPLIPPSFEWSKSTQETISVFHMLHRLQKEFG
TRICRSYVISMSHTASDLLEVLLLAKESGLIDPTLGASDLLVVPLFETVEDLQHAPSVME
SLLQSDVYRELLPRVGEKKQPLQELMLGYSDSNKDSGFLSSNWEIHKAQIALQDLASRQG
IALRIFHGRGGSVGRGGGPAYQAILAQPSGTLQGRIKITEQGEVLASKYSLPELALYNLE
TVTTAVIQNSLVTNKLDATPSWNELMTRLAARSREHYRALVHDNPDLVQFFQVVTPIEEI
SKLQISSRPARRKSGAKDLSSLRAIPWVFGWTQSRFLLPSWFGVGTALATELKADPDQME
MLRMLNQRWPFFRMLISKVEMTLSKVDLDVAHHYVVSLGGSDDRDAFASIFDIISSEYSL
TKKLILEITGKSKLLSADPALQLSVNLRNRTIVPLGFLQVALLKRLRDQNRQPPISEDVS
IDSTQSSRTYSRSELLRGALLTINGIAAGMRNTG
NT seq 2985 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaaaatccttctaacgaaaatatctctaatcactcgacagtatgtgttgaggat
caagatcctggatctttattgcaacaaaggcttgaactagtggaggatctatggaaaacc
gttctcaaaagtgaatgtccacctgatcaaacagagagattattgcgattaaaacaatta
agtgatcctagtaagtcaaatcaagacaattcctcaaaggcaatagtccaattgattaca
aaaatggatttggctgaggcgatatctgctgctagggctttttctctttattttcagttg
gtaaacattctggagcaacgcatagaagaggatagttatttagaaagcatagaaaaaggg
aagttagacaccagtaattataaaatagatccattcgctccagctttagctagtcagact
gctccagcaacttttacacaattatttgagcgattacgtcgtttgaatgtccctccagct
cagcttgatggtttgatgagagaaatggatattcgtcttgtttttacagctcatccaact
gaaatagttagacacacggttcgccataagcaacgcagggttgccactcttttgcagcaa
cttcaatctaatagcttgatttccgaatcagagaaagaaatatttaggttgcagctagag
gaggagataagactttggtggagaactgatgagcttcatcagtttaaaccgactgtcctt
gatgaggttgactatgcccttcattattttcagcaggttttgtttgatgcaatgcctcaa
ttaagaaggagactgactaccgcacttgcttcaagttatccagacgtagagatccctaat
gaagctttttgcacatttggctcttgggtaggttcagatcgtgatgggaatccgtcagtt
actcctgaaatcacatggagaacagcgtgttaccaaagacaattaatgttggataggtat
attgcatcagttcaagatctaagagaccaactcagtatatctatgcaatggagtcaagta
agttctcctttgttagagtcattggaaatggacagagttcgtttccctgaggtttatgag
gaaagggctgcaagatatagactggaaccttatcgcttgaagcttagctatacacttgag
aggctacgacttactcaactacgtaataagcagctagcggatgctggatggcaattctca
cccgatgggaagccgcaaatatctactaataatagttttgatgaagtactccactacaaa
tctgtagaagaattaaaaaatgaattagagcttattagaaatagtttggttagtacagat
cttacttgtgaaccattagatactttgctaaatcaagttcatatttttgggttctcgttg
gctagtttagacattagacaagaaagcacacgacatagtgatgcgttggatgagctcact
cgctatttagatctccctgagtcgtatggagtgatgagcgaggaaagtcgagttcaatgg
ttgatgaaagaattaagaactcggagaccacttattccgccttcttttgagtggtctaaa
agtactcaagaaactatctcagtttttcatatgcttcataggcttcagaaagaatttggt
actcgtatatgtcgctcgtatgtaatttcgatgagtcatacggcatcagatttattagaa
gttcttcttttagctaaagagtcgggtttgattgatccaactttaggagcttctgatctt
cttgttgttccattatttgaaacggttgaggacttacaacatgctccttctgtaatggag
tcgttactacaatctgatgtttatcgcgaattacttccacgagtaggagagaaaaaacaa
ccgcttcaagaacttatgctgggatattccgatagtaataaggattctggttttctctca
agtaattgggaaattcataaggcccaaatagcactccaagacctagctagtagacaagga
atagcattacgtatttttcatggtagaggtgggtccgtaggaagaggcggtggaccagct
tatcaagctattttggctcaacctagtggtacacttcagggacgtataaaaataacagag
caaggggaagtacttgcttcaaaatatagtcttccagaattagctttatataatctggaa
actgtaaccactgcagttattcaaaatagcttggttaccaataaattggatgctacgcca
agttggaatgaattgatgaccagacttgcagctcgttcaagggagcattaccgagcttta
gttcatgataatccagatttagttcaattttttcaggtagttactccaatagaagagata
agtaagttgcaaatttctagtcgtcctgctcgacgaaagagtggtgcaaaagacttatca
agtcttcgagctatcccatgggtctttggttggactcaaagtcgtttccttttgccaagt
tggtttggtgttggtacggctttagctactgaattaaaggctgaccccgaccaaatggag
atgttgcgaatgttgaatcagagatggccattctttagaatgttgatatctaaagtagag
atgacactttcaaaagttgatttagatgttgcccatcattatgtggttagtttgggtgga
agtgatgatcgggatgctttcgctagcattttcgatattatctcaagcgaatacagcttg
actaagaaattaattttagaaattactggcaagtcaaaactattaagtgcagaccctgct
ttgcagttgtctgtcaacctgagaaataggactattgtccctttaggatttttacaagtt
gctcttctcaagcgattaagagatcagaatcgtcaaccaccaattagtgaagatgtaagt
attgactctactcaaagttctcgtacatatagccgtagtgaattattgcgtggtgcattg
ttgactatcaatggtatcgctgcaggtatgagaaacacaggatga

DBGET integrated database retrieval system