KEGG   Prochlorococcus marinus MIT 9303: P9303_22741Help
Entry
P9303_22741       CDS       T00466                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pmf  Prochlorococcus marinus MIT 9303
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pmf00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    P9303_22741 (ppc)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    P9303_22741 (ppc)
   00680 Methane metabolism
    P9303_22741 (ppc)
Enzymes [BR:pmf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     P9303_22741 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CYORF: 
UniProt: 
LinkDB All DBs
Position
2009618..2012626
Genome map
AA seq 1002 aa AA seqDB search
MAKPESTSASMQQSSAQKPDCDQPRAIGEGQQAGRLLQNRLELVEDLWQTVLRSECPPDQ
AERLLRLKQLSEPLALEGADENSASTAIVLLIKEMDLAEAITAARAFSLYFQLVNILEQR
IEEDSYLASMSSGKENNRQDKPYDPFAPPLATQTDPATFSELFERLRLLNVPPAQLETLL
QEMDIRLVFTAHPTEIVRHTVRHKQRKVANLLQQLQSDPTKSSSEKESLRLQLEEEIRLW
WRTDELHQFKPSVLDEVDYALHYFQQVLFDAMPQLRRRLITAMAESYPDVHIPQAAFCTF
GSWVGSDRDGNPSVTPEITWRTACYQRQLMLERYVNAVQKLRDQLSISMQWSQVSTPLLE
SLEMDRLRFPEVYEERAARYRLEPYRLKLSYTLERLKLTQERNQQLAEAGWQTPPEGLNP
SLNLINAGEALHYKSVAEFRSDLELIRNSLVSTDLSCEPLDTLLNQVHIFAFSLASLDIR
QESTRHSDALDELTRYLNLPKAYGDMAENERVQWLIEELQTRRPLIPSAVIWSPSTAETV
AVFRMLHRLQEEFGSRICRTYVISMSHTVSDLLEVLLLAKEAGLVDPAAGHAELLVVPLF
ETVEDLQRAPAVMEALLSSPVYRNLLPRVSEQVQPLQELMLGYSDSNKDSGFLSSNWEIH
QAQIALQDLANRQGVALRLFHGRGGSVGRGGGPAYQAILAQPSGTVRGRIKITEQGEVLA
SKYSLPELALYNLETFTTAVLQNSLVTNQLDATPSWNQLMTRLAGRSREHYRALVHNNPD
LVAFFQQVTPIEEISKLQISSRPARRKSGAKDLSSLRAIPWVFGWTQSRFLLPSWFGVGT
ALAAEVESDADQLDLLRRLHQRWPFFRMLISKVEMTLSKVDLDLAHHYMTSLGSEDYREA
FNRIFEIIETEYSLTRRLVLNITGQPRLLGADPALQQSVDLRNRTIVPLGFLQVALLRKL
RDQNRQPPMNEAGDGRTYSRSELLRGALLTINGIAAGMRNTG
NT seq 3009 nt NT seq  +upstreamnt  +downstreamnt
atggccaaacctgagtccactagcgcatcgatgcagcagtcttccgcccaaaaacctgat
tgcgatcagcccagggcaatcggggaagggcagcaggcaggacgcttactgcagaaccgc
cttgaactggtggaagacctttggcaaacggtgctacgcagcgaatgtccaccggatcag
gcagaacgactacttcgactgaagcaactcagtgaacctttggcccttgaaggtgcagat
gagaacagtgccagcacagcaatcgtgctgttgatcaaagagatggacctggcagaagcg
atcaccgcagcacgcgccttctccctctatttccaactggtgaatatcctcgagcaacgg
atcgaggaagacagctacctcgcaagtatgtcttctggcaaagaaaacaatcgccaagac
aaaccctatgacccctttgctccaccgctcgccacgcagacagacccagccacattcagc
gagctgttcgaacgacttcgcctgctcaacgtgccaccagctcagctggagacccttcta
caggagatggatatccgcctagttttcactgctcatcccactgaaatcgtccgtcatacc
gttcgccataagcaacgcaaggttgcaaacctgttgcaacagttgcaatcagatccaaca
aaatcgtcatctgaaaaagaaagcctgagactgcagcttgaggaggagatcaggctctgg
tggcggaccgatgagcttcatcagttcaagccctccgttctggatgaggtggattacgcc
ctccactatttccaacaggtgctttttgatgccatgccccagctacggcgtcgcctgatc
actgcaatggccgagagctatccagatgtacacattccacaagctgccttctgcactttt
ggatcttgggttggatcagaccgagacggcaatccttccgttacaccagaaatcacctgg
cgcaccgcctgttatcaacgtcagctgatgctggagcgctatgtcaatgccgttcaaaaa
ctccgtgatcaactcagcatctccatgcaatggagccaggtaagcactccactgttggag
tcactggaaatggaccggcttcgattccccgaggtttacgaggaacgagcagcccgctat
cgactcgagccttatcgcctcaaactcagctacaccctggagaggttgaaactcactcaa
gaacgcaaccagcaattggccgaagcaggctggcaaaccccaccagaaggcctcaacccc
agtctcaatctaattaatgcgggagaagcccttcactacaaatcagtagcagaattccgc
agcgacctggaactgatccgcaacagcctggtcagcacagatctgagctgtgagcctctg
gataccctcttaaatcaggtccacatcttcgctttctcactagccagcctcgacatccgt
caggagagcactcgccacagcgatgctctcgacgaattaacccgctacctaaacctgcct
aaggcctatggcgacatggccgaaaatgagcgggtgcaatggttaatagaggaactacag
actcgccgccccctgatcccctctgccgttatctggtcgcccagtacagcagaaacggtg
gccgtgtttcgcatgctgcaccgacttcaggaggaattcggcagccgaatctgccgcaca
tatgtgatctcaatgagtcacacagtttccgatctactcgaggtgctgctgctagccaaa
gaagccggcctcgtggatccggcggctggccatgccgaactgcttgtggtgcccctattc
gaaaccgtagaggatctccagcgggctccagcagtgatggaggcacttttaagttcacct
gtctaccgcaatttgctccctcgtgtcagcgaacaggtccaacctctgcaggagctgatg
cttggctattcggacagcaacaaagactccggatttctatccagcaattgggagatccat
caagcccaaattgccctgcaagatctagctaaccgccagggtgtggctctgcgccttttc
catggacgcggtggatctgttggcagaggaggtggccctgcctaccaagcaatccttgcc
caaccaagcggaaccgtgcgcggccgaatcaagatcactgagcagggagaagtgctggca
tcgaaatacagcctgcccgagctagccctttacaacctagaaacattcactacggccgtc
ctgcaaaacagtctggtaaccaaccagctggatgccaccccaagctggaaccaactgatg
accagactggctggtcgttcacgtgagcactatcgggccctcgtccacaacaaccctgat
ctggtggccttcttccaacaggtcacgccgatcgaagaaatcagcaaattgcaaatctcc
agccgtcctgctagacgcaaaagcggcgccaaggacctctctagcctacgagcgatcccc
tgggtatttggctggacgcaaagtcgctttctactaccgagctggtttggcgtgggaaca
gcactagccgcggaagtcgaatcagacgctgaccagcttgaccttctgcgcagactgcac
caacgctggccattcttccgaatgctgatctccaaggtggagatgaccctttcaaaagta
gacctagacctggcccatcactacatgactagccttggcagcgaagattaccgtgaagcc
tttaaccgtatcttcgagatcatcgaaacggagtacagcctcacccgccggttggtctta
aacatcaccggacaacccaggttgctcggggccgatcccgccctacagcaatcagtagat
cttcgcaatcgcacgatcgtgccacttggttttctgcaagtggccctgcttcgcaaactg
cgtgatcagaaccggcagccaccaatgaacgaggctggcgatggtcgcacatacagccgc
agcgaacttctaagaggcgcactgctcaccattaacggcattgctgcaggcatgcgcaac
accggttga

DBGET integrated database retrieval system