KEGG   Prochlorococcus marinus MIT 9215: P9215_06321Help
Entry
P9215_06321       CDS       T00598                                 

Gene name
rbcS
Definition
(GenBank) Ribulose bisphosphate carboxylase, small chain
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
pmh  Prochlorococcus marinus MIT 9215
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:pmh00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    P9215_06321 (rbcS)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    P9215_06321 (rbcS)
Enzymes [BR:pmh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     P9215_06321 (rbcS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
UniProt: 
LinkDB All DBs
Position
556620..556961
Genome map
AA seq 113 aa AA seqDB search
MPFQSTVGDYQTVATLETFGFLPPMTQEEIYDQIAYIIAQGWSPVIEHVHPSGSMQTYWS
YWKLPFFGEKDLNLVVSELEACHRAYPDHHVRIIGYDAYTQSQGTAFVVFQGR
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgcctttccagagcacagtaggcgactatcaaacagttgcaaccctggaaacattcggt
ttcttaccaccgatgacccaggaggaaatatacgaccaaattgcatacataattgctcaa
ggctggagtcctgttattgagcatgttcaccctagtggaagtatgcaaacttattggtct
tattggaagctcccattctttggggaaaaagatcttaacttggttgtaagtgaattagag
gcatgtcatagagcataccctgatcatcatgtaagaatcatcggatacgatgcttacact
caaagccaaggaacagcttttgtagttttccagggacgttaa

DBGET integrated database retrieval system