KEGG   Prochlorococcus marinus MIT 9211: P9211_16951Help
Entry
P9211_16951       CDS       T00616                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pmj  Prochlorococcus marinus MIT 9211
Pathway
pmj00620  Pyruvate metabolism
pmj00680  Methane metabolism
pmj00710  Carbon fixation in photosynthetic organisms
pmj01100  Metabolic pathways
pmj01120  Microbial metabolism in diverse environments
pmj01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pmj00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    P9211_16951 (ppc)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    P9211_16951 (ppc)
   00680 Methane metabolism
    P9211_16951 (ppc)
Enzymes [BR:pmj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     P9211_16951 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ABX09626
CyanoBase: P9211_16951
UniProt: A9BCR4
LinkDB All DBs
Position
complement(1519264..1522287)
Genome map
AA seq 1007 aa AA seqDB search
MIMSKSELGNTPLEQSSDLHSSFRNNQASTTKNSGSLLQQRLALVEDLWETVLCSECPSD
QINRVLRLKKLSNPNNFAGEEEQKNPFNEIVLLIEEMDLAESIAAARAFSLYFQLVNILE
QRIEEDTYLETIGRIEEDASNQFDPFAPPLASQTAPATFSQLFERLKRLNVPPGQLEALM
QEIDIRLVFTAHPTEIVRHTVRHKQRRVANLLQQFHSEAAISFSQKESLRQQLEEEIRLW
WRTDELHQFKPTVLDEVDYALHYFQQVLFDAMPQLRRRINAALVKSYPDVEVPRESFCTF
GSWVGSDRDGNPSVTPEITWRAACYQRQLMLERYINSVQDLRDQLSISMQWSQVGSQLLE
SLEMDRVQFPEVYEERAARYRLEPYRLKISYILQRLKLTHQRNQELAAAGWKIVPEAMNS
LITSGKPFEDLYYCSIAEFRSDLELIRNSLVATDLSCESLDTLLTQVHIFGFSLASLDIR
QESNRHSDAIDEVTRFIDLPVIYSEMDEKEKVQWLMQELETRRPLIPSSVDWSPSTQETI
SVFQMLHRLQEEFGSRICRSYVISMSHSVSDLLEVLLLAKEAGLVDISSGSADLLVVPLF
ETVEDLQRAPSVMEELFSSSFYLNLLPRVGEKLQPLQELMLGYSDSNKDSGFLSSNWEIH
QAQIALQNLASSHGVALRLFHGRGGSVGRGGGPAYQAILAQPSGTLKGRIKITEQGEVLA
SKYSLPELAMYNLETVTTAVLQNSLVTNQLDATPSWNELMTRLAARSRRHYRSLVHDNPD
LVPFFQEVTPIEEISKLQISSRPTRRKSGSKDLSSLRAIPWVFGWTQSRFLLPSWFGVGH
ALFIELEEDPAQIELLKMLHQRWPFFRMLISKVEMTLSKVDLEVANHYVTSLGSRQNKEA
FNKIFEVISDEYHLTKRLVLRITGKSKLLSADPALQASVELRNRTIVPLGFLQVALLRRL
RDQKRQPPVSEELFNERDLARTYSRSELLRGALLTINGIAAGMRNTG
NT seq 3024 nt NT seq  +upstreamnt  +downstreamnt
atgatcatgtcaaaatcagaattaggcaatacacccttagagcaatcttcagatttgcat
tcatctttccgcaataaccaagcaagtactacgaaaaactctggaagcttgttgcaacag
agattggcacttgttgaagatctgtgggagacagttttatgcagtgaatgcccatcagat
caaattaatcgggttcttcgtttaaagaaattgagtaacccgaataattttgcaggagaa
gaagagcaaaaaaacccatttaatgaaattgttttgttaattgaagagatggacttggct
gagtcaattgcagccgcgcgtgcgttctctttatactttcaacttgtcaatattttggag
cagagaattgaggaagacacatatctagaaactattggcaggatcgaagaagatgcgtct
aatcaatttgatccatttgcccctcctcttgcgagtcagactgcaccagcaactttcagt
caattatttgaacgtttaaaacgtcttaatgtccctcctgggcagctagaggcattaatg
caagaaatagatatacgtcttgtctttaccgcccatcctacagaaatagtccgacatacc
gttaggcataagcaacgcagggtagccaatttgttacagcaatttcactctgaagcagca
atttctttctctcagaaagaaagcttgcgacaacagttagaagaagaaatacgtctttgg
tggcgtacagatgagctacatcaatttaaaccaactgttttagacgaggtagattatgca
ctgcattatttccaacaagttctatttgacgcgatgccccaattgcgtcgtcggattaat
gcagcattagttaaaagttatcctgatgttgaggtgcctagagaatctttttgcacattt
ggttcttgggtggggtcagatcgtgatggcaacccatcagttactccggaaataacttgg
agagcagcatgttatcaacgtcaattaatgcttgagcggtatatcaactctgttcaagac
cttagggatcaattgagtatttctatgcaatggagtcaggttggctcacaattgttagag
tctttagaaatggatagagttcagtttccagaggtttacgaggaaagagcagcgagatac
aggctagagccatatcgactaaagattagctatattttgcaacgacttaagctaactcat
caacgtaatcaagaattagcagctgcaggatggaagatagttcctgaagctatgaactcc
ttgattacttctggtaagccatttgaggatttgtattactgctctatagccgagtttcgt
agtgatctagagttaattcgcaatagcctggtggcaacagatcttagttgtgagtcgtta
gatacgctattgactcaggtacatatttttggcttttctcttgctagtctggatattcga
caagagagtaaccgacatagtgatgctatagacgaggttacaagatttatagacctccct
gtcatctactcagaaatggatgagaaagaaaaagttcaatggttaatgcaagaattagaa
actcgtaggccattaattccttcttcagttgattggtcaccttctactcaggaaacaata
tctgtttttcagatgctccaccgtttacaggaagagtttggtagtcggatttgcagatct
tatgtaatttcaatgagtcattcagtttctgatcttttagaagtacttcttctcgcaaaa
gaagctggactagtagatatttcgtctggttcagctgatttactagtggtgcctttattt
gaaactgttgaggatctgcagcgagctccctcagtgatggaggaactctttagctctagt
ttttatctcaacttattacctcgtgttggagagaaacttcagcctttacaagaactaatg
cttggttattcagatagcaataaagattctggttttttatcaagtaattgggaaattcat
caggcacaaattgcacttcagaaccttgcaagtagtcatggtgtagctttacgtttattt
cacggtcgtggaggttctgttgggcgaggtggtggccctgcttatcaggcaatcttggct
caacctagtggcactttaaaaggacgaattaagattactgagcaaggggaagttcttgct
tcaaaatatagcctacctgaactagcaatgtataacctcgaaactgttacgacagctgtg
ctgcaaaatagtttggttactaatcagttagatgcaacccctagttggaatgagctgatg
actcgattggcagcgcgttctaggcggcattacaggtcgcttgtacatgacaaccctgac
ttggtgccattttttcaagaagtgacgccaattgaagaaatcagtaaattgcaaatttct
agtcgacctactcgtagaaaatcaggcagtaaggatttatctagtcttagggccatacct
tgggtctttggttggactcagagtaggtttcttttgcccagttggtttggagtcgggcat
gctttgtttatagaacttgaagaagatcctgcacaaattgagcttttgaaaatgcttcat
cagcgttggcctttctttcgaatgttgatttctaaggtagagatgactctttcgaaagta
gatctagaggtggctaatcactatgtcactagtcttggtagtaggcagaataaagaagct
tttaataaaatttttgaggtgatttctgatgaataccatctcactaagaggttggtttta
agaataactggaaaatcaaaacttcttagcgctgatcctgcattgcaagcgtctgtagag
cttagaaaccgtacgattgtacctttagggtttcttcaagtggcactattacgtcgatta
cgtgatcaaaagcgtcaaccacctgtgagcgaggagctttttaatgaacgagatcttgct
cgtacttatagtcgcagtgaattattgagaggagctttgttgactattaatggcattgct
gcgggaatgcgaaatacaggttga

DBGET integrated database retrieval system