KEGG   Pseudomonas mendocina NK-01: MDS_2413Help
Entry
MDS_2413          CDS       T01473                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
pmk  Pseudomonas mendocina NK-01
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:pmk00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    MDS_2413
Enzymes [BR:pmk01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     MDS_2413
DNA repair and recombination proteins [BR:pmk03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     MDS_2413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2635042..2637570
Genome map
AA seq 842 aa AA seqDB search
MARAQSEYNRKRNFEQTSEPREQPRKRRSKAGALRFVVQKHDARRLHYDFRLELDGTLKS
WAVPKGPSLDPTQKRLAVHVEDHPLDYASFEGSIAEGNYGAGDVIVWDHGIWQPQGDPAG
AYQAGKLKFTLVGEKLSGDWTLVRTRLRGSGDKEQWLLIKERDDIARPSDEYDIVEAQPQ
SVISGALVGGPSKEAKRKESTKPAKSRKAQTEFPDSLAPQLATLAERPPEGDWLYEVKFD
GYRILARMRGDEVRLLTRNGHDWTERLPQQATALAKLGLSDSWLDGEVVALNEQGLPDFQ
QLQNAFDIGRSHDLIYYLFDAPFLNGEDMREVPLETRRGKLKTALGSTRRSPLRFSEAFT
AHHRDIVESACAMSLEGVIGKRSGSLYVSRRSADWIKLKCRLRQEFVIVGYTKPQGSRSG
FGALLLAVNEAGGLRYAGRVGTGFGEASLKALHEQLRKLGRDESPLERKLTAALARGVSW
VEPQLVGEVEFAEWTREGIVRQASFIALRSDKPTAQIVREHPRAPGAAAKKQTKKAESSC
KSSAKPVVAGVPISNPQRVIDPESGTTKLQLAQFYADIAEWLLPYLRKRPVSLVRAPDGV
EGEQFFQKHAERLAIPNIKHLDPKLDPGHARLMEIDSVPALVGAAQMGCIEFHRWGATSD
RIETPDHFVLDLDPDPALPWRSMLEATRLTLSVLDELGLQAFLKTSGGKGMHIIVPLARH
AGWDTVKGFAKALAQFMARQLPERFTATSGPKNRVGKIFIDYLRNGRGASTVSAYSVRAR
PGLPVSVPIARDELDGLRSAQQWTVANLQRRLDGLRQDPWAGYANRQRLTRAMWDRLGAE
AP
NT seq 2529 nt NT seq  +upstreamnt  +downstreamnt
atggccagagcgcagagcgaatacaaccgcaaacgcaatttcgagcagaccagcgaaccc
cgcgaacaaccgcgcaagcgccgcagcaaggccggtgcattgcgtttcgtggtgcagaag
cacgatgcgcgccgcctgcactacgactttcgcctggaactggacggcactctgaagagc
tgggcggtgcccaaggggccgagcctggacccgacgcaaaagcgcctggcggtgcacgtc
gaggatcacccgctggattacgccagcttcgagggcagcatcgccgaaggcaactatggc
gccggcgatgtgatcgtctgggaccatggcatctggcagccgcagggcgacccggcgggt
gcctaccaggccggcaagctcaagttcactctggtgggcgagaaactgtccggggactgg
acgctggtgcgcactcgtctgcgcggcagtggcgacaaggagcagtggctactgatcaag
gagcgcgacgacatcgcgcgccccagcgacgagtacgacatcgtcgaggcacagccacaa
agcgtgatcagcggcgcgctggtgggaggcccaagcaaggaggccaagcgcaaggaatcg
acgaaaccggcaaaaagtcgcaaggcccagacggagttccccgacagccttgcgccgcaa
ctggcgaccctggccgagcgtccgcccgaaggcgactggctgtatgaggtgaagttcgac
ggttaccgcatcctggcgcggatgcgcggcgatgaggtgcgtctgctcacccgcaatggc
catgactggacggagcgcctgccgcaacaggccacggctctggccaagctgggcctgagc
gacagctggctggacggagaggtcgtggcgctcaatgagcaaggcctgccggacttccag
caactgcagaatgccttcgatatcggccgcagccacgatctcatctactacctgttcgat
gcgccgtttctcaacggcgaagacatgcgcgaggtgcccctggagactcggcgcggcaaa
ctcaagactgcattgggcagcacgcggcgcagcccgctgcgtttttcggaggcttttacc
gcccatcacagggacatcgtcgagagcgcctgcgccatgtcgctggaaggcgtcatcggc
aagcgctcgggcagcctttacgtgtcgcgccgcagcgcggactggatcaagctcaaatgc
cgtctgcgccaggagttcgtcatcgtcggctacactaagccgcagggcagtcgcagcggc
tttggcgcgctgctgttggcggtgaacgaggcgggcgggctgcgctatgccgggcgggtc
ggcaccggcttcggggaagcctcgctcaaggccctgcatgagcagttgcgcaagctgggg
cgagacgagtcgccactcgagcggaaactgaccgctgccctggcccgcggtgtgagctgg
gttgagccgcaactggtcggcgaggtcgagttcgccgaatggacgcgtgaaggcatcgtg
cgccaggccagcttcatcgccttgcgcagtgacaagccgacggcgcagatcgttcgtgag
catccgcgtgcgccaggcgctgcagcgaagaaacagaccaagaaggccgaaagctcgtgc
aagtcatccgccaagccggtggtggccggggtgccgatcagcaatccgcagcgggtgatc
gacccggaaagcggcaccacgaaactgcagctcgctcagttctacgcggatatcgccgaa
tggttgctaccgtacctgcgcaaacggccggtctcgctggtgcgggcgccggacggggta
gagggggaacaattcttccagaagcatgccgagcgcctggcaatccccaacatcaagcat
ctcgatcccaagctggatcccggccacgcgcgcctcatggaaatcgacagtgtgccagcc
ctggtcggtgcagcgcagatgggctgcatcgagttccaccgctggggcgctaccagcgac
cgcatcgaaacgcccgatcatttcgtgctcgatctcgacccggacccggcgctgccgtgg
cgcagcatgctggaggcgacccggctgaccctgagcgtgctcgacgaactgggtctgcag
gcatttctcaagaccagcggtggcaaaggcatgcacatcatcgtgccgcttgcccggcac
gccggctgggatacggtcaagggcttcgccaaggccctggcgcagttcatggccaggcag
ctacccgagcgattcaccgcgacgtcggggccgaagaatcgggtggggaaaatcttcatc
gactatctgcgcaacggccgtggcgccagtacggtgtcggcctactcggtgcgcgcgcgg
ccaggcctgccggtttcggtaccgatcgcccgggacgaactggacggcctgcgcagcgcc
cagcaatggacggtcgccaatctgcagcgacgcctggacgggctgcgccaggacccctgg
gccggctatgccaaccgccagcgcctgacccgcgcgatgtgggaccggctcggcgccgaa
gcaccatga

DBGET integrated database retrieval system