KEGG   Pseudomonas mendocina NK-01: MDS_4295Help
Entry
MDS_4295          CDS       T01473                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
pmk  Pseudomonas mendocina NK-01
Brite
Translation factors [BR:pmk03012]
 Eukaryotic Type
  Elongation factors
   MDS_4295
 Prokaryotic Type
   MDS_4295
Mitochondrial biogenesis [BR:pmk03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    MDS_4295
Exosome [BR:pmk04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   MDS_4295
  Exosomal proteins of breast cancer cells
   MDS_4295
  Exosomal proteins of colorectal cancer cells
   MDS_4295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(4693730..4694923)
Genome map
AA seq 397 aa AA seqDB search
MAKEKFERNKPHVNVGTIGHVDHGKTTLTAALTRVCSEVFGSAKVDFDKIDSAPEEKARG
ITINTAHVEYDSNIRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLSRQVGVPYIVVFLNKADMVDDAELLELVEMEVRDLLSTYDFPGDDTPIIIGSALMALN
GEDANELGTTAVKKLVETLDSYIPEPVRAIDRPFLMPIEDVFSISGRGTVVTGRVERGIV
KIQEEIEIVGLRPTTKTTCTGVEMFRKLLDEGRAGENCGVLLRGTKRDEVERGQVLAKPG
TIKPHTKFEAEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGSCELPEGVEMVMPGDNI
KMVVTLIKPIAMEDGLRFAIREGGRTVGAGVVAKIIE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
gtggctaaggaaaaattcgaacgtaacaaaccgcacgtcaacgtcggcaccatcggtcac
gttgaccacggtaagaccactctgaccgctgctctgacccgcgtctgctccgaagttttc
ggttcggccaaggttgacttcgacaagatcgacagcgctccggaagaaaaagctcgtggt
atcaccatcaacaccgcgcacgtagagtacgactccaatattcgtcactacgcgcacgtt
gactgcccgggccacgccgactacgtgaagaacatgatcaccggtgctgcccagatggac
ggcgcgatcctggtctgctcggctgccgacggccccatgccgcaaacccgtgagcacatc
ctgctgtcccgtcaggttggcgttccgtacatcgttgtcttcctgaacaaggctgacatg
gttgacgacgccgagctgctggagctggtcgagatggaagttcgcgacctgctgagcacc
tacgatttcccgggtgacgacactccgatcatcatcggctccgcgctgatggctctgaac
ggtgaagatgccaacgagctgggcactactgccgttaagaagctggttgagactctggat
agctacattcctgagccggttcgtgccatcgatcgtccgttcctgatgccgatcgaagac
gtgttctcgatctccggccgcggtactgttgtgaccggtcgtgtagagcgcggtatcgtc
aagatccaggaagaaatcgaaatcgttggtctgcgtccgaccaccaaaaccacctgcacc
ggcgttgagatgttccgcaagctgctggatgaaggtcgtgctggtgagaactgcggcgtg
ctgctgcgcggcaccaagcgtgatgaagtcgagcgtggtcaggttctggccaagccgggc
accatcaagccgcacaccaagttcgaagctgaagtgtacgttctgtccaaggaagaaggt
ggtcgtcacaccccgttcttcaagggctaccgtccgcagttctacttccgtaccactgac
gtgaccggttcgtgcgaactgccggaaggcgttgagatggtaatgccgggcgacaacatc
aaaatggttgtcaccctgatcaagccgatcgccatggaagacggcctgcgcttcgcaatt
cgcgaaggtggtcgtaccgttggcgccggcgtggttgccaagatcatcgagtaa

DBGET integrated database retrieval system