KEGG   Petrotoga mobilis: Pmob_0585Help
Entry
Pmob_0585         CDS       T00621                                 

Definition
(GenBank) pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
pmo  Petrotoga mobilis
Pathway
pmo00010  Glycolysis / Gluconeogenesis
pmo00020  Citrate cycle (TCA cycle)
pmo00620  Pyruvate metabolism
pmo00640  Propanoate metabolism
pmo00650  Butanoate metabolism
pmo00680  Methane metabolism
pmo01100  Metabolic pathways
pmo01120  Microbial metabolism in diverse environments
pmo01130  Biosynthesis of antibiotics
pmo01200  Carbon metabolism
Module
pmo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pmo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pmob_0585
   00020 Citrate cycle (TCA cycle)
    Pmob_0585
   00620 Pyruvate metabolism
    Pmob_0585
   00640 Propanoate metabolism
    Pmob_0585
   00650 Butanoate metabolism
    Pmob_0585
  Energy metabolism
   00680 Methane metabolism
    Pmob_0585
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Pmob_0585
Enzymes [BR:pmo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Pmob_0585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II TPP_enzyme_N Transketolase_C Tae4 DXP_redisom_C
Motif
Other DBs
NCBI-ProteinID: ABX31319
JGI: Pmob0585
UniProt: A9BH89
LinkDB All DBs
Position
complement(637155..638324)
Genome map
AA seq 389 aa AA seqDB search
MPVKLTVTGAAAVAHAMRQINPDVVAAYPITPQTPIVEYYAGFVSDGIVDTILVPVESEH
SAMSAVIGSAASGARTMTATAANGLALMLEIVYIAASYRLPIIMPVVNRALSGPINIHCD
HSDAMMARDSGWIQFFTENHQEAYDFTIMATKLAEKENVLLPAMVNLDGFITSHGVESFE
MLDDEVVREFVGSWNPKYSLLDTKNPVSFGPLDLFDYYFEHHRQQEEAMTNAYKELPRVF
EEFEKISGRRYDFLDLYKVNDADYIMVVMNSTASTAKYVVDQLREEGHKVGLVKPQVFTP
FPKKEFQQALNGRKGVVVLDRAMSFGKEAPLYSLVKSSLYEVASRPSLGSYIYGLGGRDT
TPEMIREAFEDALQGNLIADEQRYLGLRE
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtaaaactaacggttactggagctgctgctgttgcacatgctatgagacaaatc
aatccagatgtagtagcagcttacccaataacaccacaaacaccaattgttgaatattat
gcaggatttgtatccgatggtattgtagataccatattggttcctgtggagtcagaacac
tccgcgatgagtgcggtaataggttcggcggcctctggggctagaactatgacagccact
gctgcaaatgggttggcattgatgctagaaatagtttatatagctgcttcttacaggctc
cctataataatgcctgtagtcaatagggcattatcagggcccattaatattcactgtgat
cattccgatgcaatgatggcaagagattctggatggattcaattcttcactgaaaaccat
caagaagcctatgattttacaataatggcaactaaattggcggaaaaagagaatgtattg
ttgcctgcaatggtgaatttagatggtttcattacctctcatggagtggaaagcttcgag
atgttagatgatgaagtggtaagggagtttgttggaagttggaaccctaaatactctctt
ttagatactaaaaatcctgtttcctttggtccattggacctttttgattattacttcgaa
catcatcgtcaacaagaagaagctatgacaaatgcttacaaagagcttcccagagtattt
gaggaatttgaaaagatatctggaagaagatacgattttctggatttgtacaaagtgaat
gatgctgattatataatggttgttatgaattctactgcatctacagcaaagtatgttgta
gaccagcttagagaagaaggacataaggttggattggtgaagcctcaagtctttactcct
ttccctaagaaggagtttcagcaagctttaaatggaagaaagggagtagttgttttagac
agagcaatgtcttttgggaaagaagctcccctatattctttagtaaaatcttctttgtac
gaagttgcttctcgaccttctttaggttcttatatttatggtttaggaggaagagacaca
acccctgaaatgataagagaagcatttgaagatgcccttcagggtaatctaatagctgat
gaacaaagatacttgggattaagagaataa

DBGET integrated database retrieval system