KEGG   Pasteurella multocida 36950: Pmu_01620Help
Entry
Pmu_01620         CDS       T01729                                 

Gene name
nanB
Definition
(GenBank) sialidase B
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
pmp  Pasteurella multocida 36950
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:pmp00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Pmu_01620 (nanB)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Pmu_01620 (nanB)
Enzymes [BR:pmp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     Pmu_01620 (nanB)
Bacterial toxins [BR:pmp02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   Pmu_01620 (nanB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
169596..172751
Genome map
AA seq 1051 aa AA seqDB search
MKKFNPSILALSISSLLLTSTLTFGQIQQQDKALFGVKEHQESLLFHQSLVEQGSDNVPI
WRIPSLLRTKDGVLIAAADKRWQHRGDWGDIDTAIRISHDDGKTWGNITTILDLPSKNGE
KSPSAPDPVTFNAWGDRQNCTTYCNSAFLIDAQMVQDKRNGRIFLAVDMFADGAGFFGVK
DSGNGRINIDGKQYPILNEKQSGQRWTLRENGEVFDHENKKTSYRVVVEGNPKLNFKDLG
DIYNERNEKVGNIYLKDRNTPFLAINTAYVWLIHSDDNGKTWSNPIDLSAQVKKDWMKFF
GTGPGVGIQTKNGSLLFPIYYTNQHGKQSSALVISKDGGKTWDLGASPNDSRPDLYGQNS
QTLRTNQRGHELTESQLIELENGDLKLFMRNTSGRVIMSTSKDGGYTWLDTHQVSELKHG
YSQLSVIKYSKKINGKEYIVFSGQSESGQSGDSLRRNGKLFLGEVQEDGSIVWKTDKLVR
EIQSSGKANRTHPNGYVYSSMAELGDGSIGLAYENTTDYTTIMYLPIEMQEFFWRDGKIF
SDIRQKTPLTVTYNGADSLEKIGDGIAIKQGVGESLGGVTVSEGTLVLAQKSEQDKNKAF
TDVTLNKTGILQVESVQNIDTLTVNNEASGHIQLSVSDESTPMLNIAKGVSGKEVKLHVN
LQKKLKPNDKGYYHAQGEELIAFKDNGQVKWRLVNDELKDGMYVYTLASVVKPSVLRTTS
QPHSLYLTNKLITADGKAVSTVAPLKAPLTVNARPQVNPVLASYLTANLALNKMSEQLQQ
SFMHETRLLQEKDRSIFVKYLNGKQKYGSNLSFIDYGYDFNASYSGVMLGGKVWQSERGN
HALYTALNKTSYKVTPKAVDGETKAKYQSWGGSINWHSNLPHNLIVDLSAGYQKHKGDIE
HAGHVKGYTFNIGADLGYRYQWMKNAFITPMVGLHYLYASLSDVNDQANKALLKYNNFNA
LKTNLGVDVNYRIGKFEVKGLLSYDMYQQKTRQLYVDDVAYKQGKLADTLHLNTQFVAHL
TPRFAFSTEVGFQHARNKGQSSFAVGAHYQF
NT seq 3156 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatttaatcctagtatattggcgttgtccatatcaagtctgctactcacatcc
acattgacctttggtcaaatccagcaacaagataaagcactctttggtgtgaaagaacat
caagaaagcctactctttcatcagagcttagtagaacaaggtagtgataatgtgccaatt
tggcgcattccgtctttattaagaacaaaagacggtgtattaattgccgccgcagataag
cgttggcaacaccgtggtgactggggcgatattgataccgcaatccgaattagtcatgat
gatgggaaaacatggggaaatattacaacgattttggatttgccatcaaagaatggggaa
aaatccccatcagcaccagatcctgtaacattcaacgcgtggggagatagacaaaattgt
acaacttactgtaattctgcttttttgatcgatgctcagatggtacaagataaacgtaat
ggtagaatttttttagcagttgatatgtttgccgatggagcaggtttttttggtgtaaaa
gacagtggtaatgggcgcattaatattgatggtaaacagtatcctattttaaatgaaaag
caatcgggtcaacgttggactcttcgtgaaaatggagaggttttcgatcatgagaataag
aaaacatcttatagagttgttgtagaagggaatccaaaattaaactttaaagatttggga
gatatttataatgagagaaatgagaaagttggaaatatttatttgaaagataggaataca
ccatttttagccattaatactgcatatgtttggttaatccattcggatgataatggaaaa
acttggtcaaatcctattgatttaagtgcacaagtgaagaaagattggatgaagtttttt
ggtacaggtcctggtgttggaatccaaacaaagaatggaagtttactttttcctatttat
tacactaatcaacatggtaagcaatcatcagcattggttattagtaaagatggtggtaaa
acttgggatttgggcgctagccctaatgatagccgtccagatttgtatgggcaaaactct
caaacgcttcgaacaaatcagcgtggacatgagctaacagaatctcaacttatcgagctt
gagaatggtgatttgaaactttttatgcgtaatacaagtggaagagtgattatgtccaca
tcaaaagatggtggatatacttggttagatactcatcaggtcagtgaattaaaacatggt
tattctcaactttcagtgattaaatattctaaaaaaattaatggaaaagaatatattgtt
ttttcagggcaatcagaatcaggacaaagtggagattctttacgccgtaatgggaaacta
tttttaggtgaagtccaagaagatggttctattgtttggaaaactgataagttagtacga
gagattcaaagttctggaaaagcaaatagaacacatccaaacggctatgtttacagctca
atggcggaattaggtgatggcagtattggtttagcttatgaaaatacgacagactacacc
acaatcatgtatctccctattgaaatgcaagaatttttctggcgtgatggcaaaatattc
agtgatatccgccaaaaaacaccattaactgttacttataacggtgcagactcccttgaa
aaaataggtgatggtattgcgattaagcaaggtgtaggagaaagtttaggcggtgtgaca
gtcagtgaagggaccttagttttagcgcaaaaatcagaacaagataaaaataaagctttt
acagatgttacgctcaataaaacaggtattctacaagttgaatcagtgcaaaatattgat
acattaactgtcaataatgaagcatcagggcatattcaacttagtgtttcagatgagagc
acaccgatgttaaatattgcgaaaggggtatctggtaaagaagttaagctgcatgtcaac
ttacagaaaaaactcaaaccaaatgataaaggttattaccatgcccaaggagaagaacta
atcgcatttaaggataatggacaagtcaaatggcgtttagttaacgatgaactaaaagat
ggcatgtatgtttatactttggcttcagtggttaaaccaagtgttttacgtacaacaagt
cagccacattcactctatttaacaaataagttaattacagcagatggtaaagccgtatcc
acggtggctccattgaaagcaccattaaccgtaaatgctcgcccacaagtgaatccggta
ttagcttcttatttaaccgccaatcttgcgcttaataaaatgagcgagcaacttcagcaa
agttttatgcatgaaacgcgtttattgcaagaaaaagatcgcagtatttttgttaagtat
cttaatggtaaacaaaaatatggctcaaacttaagctttattgactatgggtatgatttt
aatgcgagttatagcggtgtgatgttgggaggcaaagtatggcagtctgaacgtggtaac
catgccctgtatacagcattgaataaaacgtcctataaagtgacgccgaaagctgtagat
ggtgagacgaaagcgaaataccaaagttggggaggaagtataaattggcatagtaacttg
cctcacaatctgatagtagatttatcagctggctatcaaaaacataagggcgacattgaa
catgcaggtcatgtgaaaggttatacttttaatattggtgcggatttaggttatcgctat
caatggatgaaaaatgcgtttattacaccaatggtcggtttgcattatttatatgcctcg
ctttcagatgtcaatgaccaagcgaataaagcgttattgaaatataataatttcaatgcg
ttaaaaacgaatttaggtgttgatgtgaactatcgaatcgggaagtttgaagtaaaaggt
ctactttcttacgatatgtatcaacaaaaaacacgtcaattgtatgttgatgatgtagct
tataagcaaggtaaactggctgatacacttcatttaaatacacaattcgttgcccattta
actccacgttttgcattttcaacggaagttggtttccagcatgcgcggaataaaggacag
tcttcctttgctgttggggcacattatcagttctaa

DBGET integrated database retrieval system