KEGG   Proteus mirabilis HI4320: PMI1407Help
Entry
PMI1407           CDS       T00753                                 

Gene name
gadB
Definition
(GenBank) glutamate decarboxylase beta
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
pmr  Proteus mirabilis HI4320
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Quorum sensing
Brite
KEGG Orthology (KO) [BR:pmr00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    PMI1407 (gadB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PMI1407 (gadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PMI1407 (gadB)
   00430 Taurine and hypotaurine metabolism
    PMI1407 (gadB)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    PMI1407 (gadB)
Enzymes [BR:pmr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     PMI1407 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1485617..1487008)
Genome map
AA seq 463 aa AA seqDB search
MNKKTPSYSSLDDVYASVDLSQSLPKTHFPQQESHPRHVFDAVRDELMLDGNSRQNLATF
CQTWVDDEIRDLMNLSIDKNMIDKDEYPQTAEIENRCVHMLADLWHSPDPLNTLGCSTIG
SSEAAMLGGLALKWQWRKKRLAAGKATDKPNLICGPVQVCWHKFARYFDVELREIPLEGD
RLMMSPEEVIKRVDENTIGVVPTLGVTFTCTYEPVKAVHDALDQLQKETGLDIPIHVDGA
SGGFLAPFCAPDLEWDFRLPRVKSINSSGHKFGLAPLGSGWVVWREAKDLPEELIFNVNY
LGGNMPTFALNFSRPGGQIIAQYYNFLRLGREGYAKIHNACYHTAQYLAREIEKLGPFEM
IFSGDSQKGIPALAWKLKKEAKVSYSLYDIADKLRSRGWQVPAYSMPADRQDLVIQRILV
RHGVSLDLATLLIEDMKRTLDYFEKHPVSTPLSEEDGGGFNHS
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaaacgccaagttatagctcactcgatgatgtttatgcatcggttgattta
tcacaatccttaccgaaaacacattttccgcaacaagagagccatcctcgtcatgttttt
gatgctgtaagggatgagctgatgctagatggcaattcaagacaaaatctggccacattt
tgtcaaacctgggtagatgatgagatccgtgatttgatgaatttatctatcgataagaac
atgatagataaagatgaatatccacaaacggccgaaattgaaaaccgttgtgttcatatg
cttgctgatttatggcactcacccgatccactcaataccctaggttgttcaaccattggc
tcctctgaagcggcaatgctggggggacttgcattaaaatggcaatggcgtaaaaaacgc
cttgctgctggaaaagcgacagataaacctaatcttatttgtgggccagttcaagtctgt
tggcataaatttgcccgttattttgacgttgaactcagagagatcccgcttgaaggtgat
cgcttgatgatgagtcctgaagaggtcattaaacgtgttgatgaaaatactatcggtgta
gtgccaacattaggggtgaccttcacctgtacttatgagccagtaaaagcggtacatgat
gcactcgaccaactacaaaaagagaccggacttgatattcctattcatgttgatggtgcg
agtggtggctttttagcgcctttctgtgcacctgatttagaatgggatttccgtttaccg
cgtgttaaatccattaactcatcaggccataagtttggtttagcgccattgggctctggt
tgggtagtatggcgtgaagccaaagacttaccggaagagcttatttttaatgtgaactac
cttggcggtaatatgccaacctttgcgcttaatttctcacgtcccggtgggcaaattatt
gctcaatactataatttcttgcgtcttggcagagaagggtatgcgaagatccacaatgcc
tgttatcacaccgcgcaataccttgctcgagaaattgaaaagctagggccttttgaaatg
atcttcagtggtgatagtcaaaaaggaatacctgcattagcgtggaaactgaaaaaagag
gctaaggtaagctactccttatatgacatcgctgataaattgcgtagccgtggctggcaa
gtacccgcttattctatgcctgctgatcgccaagatttagttattcaacgtattcttgtt
cgtcatggtgtgagtttagatttggcgacattactgatagaagatatgaaacgtactctc
gattatttcgaaaaacatcctgtcagcacacctttatctgaagaggacggcggtggcttt
aaccacagctaa

DBGET integrated database retrieval system